(data stored in ACNUC7421 zone)

EMBL: CP001791.PE422

CP001791.PE422       Location/Qualifiers
FT   CDS_pept        462719..464719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0436"
FT                   /product="TRAP transporter, 4TM/12TM fusion protein"
FT                   /note="KEGG: pcr:Pcryo_0743 TRAP transporter, 4TM/12TM
FT                   fusion protein; TIGRFAM: TRAP transporter, 4TM/12TM fusion
FT                   protein; PFAM: TRAP C4-dicarboxylate transport system
FT                   permease DctM subunit; Citrate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97974"
FT                   /db_xref="GOA:D6XXB7"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="InterPro:IPR011853"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXB7"
FT                   /inference="protein motif:TFAM:TIGR02123"
FT                   /protein_id="ADH97974.1"
FT                   /translation="MSKEAVPNEQTKEVLEKYDNESRVRSYRKYYVGLIVSIIAISLSV
FT                   YHLYTSYFGTPVTLQHRSIHVAVVLALIFLIYPAYKKLDRRKLHWYDVILAMMAISTTV
FT                   YIYIDYDGIVRRGGMPNEWDLVFGLILVALVLEGARRVTGWALPLLATLFIAYGLYGNH
FT                   LSGLFRHRGYEWSDIVNFMYVTTEGVYGTAISVSATYIFLFILFGAFLQKSGMGQFFND
FT                   LALAIAGQTKGGPAKVSVIASGFLGSINGAAVANVVTTGSFTIPLMKKIGYKKDFAGAV
FT                   EASASVGGQILPPIMGAAAFIMAEILGIAYRDIALAALLPALLFYLGVIIQIHLRATKE
FT                   GLQGISKENLPLVKNVMMERGHLLIPLLFLMYMLFLSGRTIIFSAFLTILVTVAVSMIR
FT                   KTTRMSVKDIIGALDNGARTALAVAIACASVGIIVGIATLTGFGLKLANGIVILGGESL
FT                   FLTLMFTMVASIVLGMGLPSIPTYIITATMAAPALVQLGIEPLVAHLFVFYFGIFANIT
FT                   PPVALAAFAAAGISGGRQMRTGGISMKLALAGFIVPYIFVYNSNLLLINTTIMQGIVVV
FT                   ITSVIGVTMLSFAAEGYFFTKMNWLFRAVLFGGALLFMNPNGYQDLIAILILVAVGILQ
FT                   YMKAKKEGGINLPLEGYRDRYDQEEPAIVTT"
     atgagcaagg aagcggtccc gaacgaacaa acgaaggaag tccttgagaa atatgacaat        60
     gaatcgagag tcagaagcta ccggaagtat tatgtgggtc tcatcgtatc catcatcgcc       120
     atcagtctgt cggtgtatca tttgtacacg tcttactttg gtacaccggt taccttgcag       180
     caccggtcga tccacgtggc agtggtcctt gccctgatct ttttgattta tccggcttac       240
     aagaagctcg accgcaggaa gctgcactgg tatgacgtga tcctcgccat gatggcgatc       300
     tcgacaacgg tctacatcta tattgattac gacggcatcg ttcgcagggg cggtatgccg       360
     aacgaatggg atctcgtctt tgggctgatc ctcgttgccc tcgtccttga aggcgcgaga       420
     cgcgtcaccg gttgggcgtt gcctcttctt gccacgctgt ttatcgccta tggcctgtac       480
     ggcaatcacc tgtccggtct gttccggcat cgtggctatg agtggagtga tatcgtcaac       540
     ttcatgtatg tgacaacgga aggggtttac ggaacggcca tttcagtatc ggcaacgtac       600
     atcttcctct ttattctctt tggcgcgttc ttacagaagt cggggatggg tcagttcttt       660
     aacgatctcg ccctggcgat tgccggacag acgaagggcg gaccggcgaa agtgtccgtc       720
     attgccagcg ggtttctcgg cagtattaac ggcgcggccg tggcgaacgt cgtgacaacg       780
     gggtcgttta cgattccttt aatgaagaag attgggtata agaaggattt cgctggcgcc       840
     gtcgaggcat ctgcgagtgt cggggggcag attttgccgc cgatcatggg ggcggctgct       900
     ttcatcatgg ccgagattct cgggattgca taccgggata tcgcccttgc ggcactattg       960
     ccggcactgc tcttctatct tggggtcatc atacagattc acctccgtgc gacaaaagaa      1020
     ggcctgcagg ggatttccaa agagaacttg ccgcttgtga agaacgtgat gatggaacgc      1080
     ggccatctgt tgatcccgct cttgttcctg atgtatatgc tcttccttag cggacggacg      1140
     attattttct cagcgtttct cacgattctc gtgactgtag ctgtatcgat gattcgaaag      1200
     acgacaagga tgtcggtgaa agacatcatc ggggcactgg ataacggtgc gagaacggcg      1260
     cttgccgtgg cgattgcctg tgcgagtgtc ggcatcatcg tcgggattgc cacattgaca      1320
     ggcttcgggc tgaagcttgc caacgggatt gtcatccttg gcggtgaatc cctgttcctg      1380
     acgctcatgt tcaccatggt ggcgtcgatc gtcctcggca tgggtcttcc gagtatcccg      1440
     acgtatatca tcacggcgac tatggcggca cctgcccttg tgcaactcgg cattgaaccg      1500
     ctcgtggccc acctgtttgt tttctacttc gggatctttg cgaacatcac gccgccggtg      1560
     gctctggctg ctttcgctgc agcggggata tccgggggac ggcagatgag gaccgggggc      1620
     atctcgatga agctcgccct ggccggattt atcgtcccgt atatctttgt ctataacagc      1680
     aatcttctgc ttatcaatac aacgattatg caagggatcg tcgttgtcat cacttccgtg      1740
     atcggggtga cgatgctgag tttcgcagca gaaggctatt tcttcacgaa aatgaactgg      1800
     ctgttccggg ctgtcctctt tggcggtgcg ctcctgttca tgaatccgaa cggttatcag      1860
     gatctcatcg ccattttgat ccttgttgcc gtcggtattt tgcaatatat gaaagcgaag      1920
     aaagaaggcg ggatcaacct gcctcttgaa ggctaccggg accgctacga ccaggaggaa      1980
     ccggcgattg ttaccacgta a                                                2001
//

If you have problems or comments...

PBIL Back to PBIL home page