(data stored in ACNUC7421 zone)

EMBL: CP001791.PE426

CP001791.PE426       Location/Qualifiers
FT   CDS_pept        467376..468518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0440"
FT                   /product="beta-lactamase domain protein"
FT                   /note="KEGG: hha:Hhal_1932 beta-lactamase domain-containing
FT                   protein; PFAM: beta-lactamase domain protein; SMART:
FT                   Rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97978"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXC1"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ADH97978.1"
FT                   /translation="MSLKVMTANELGQKIIAREDLFILDVRNEDAYQDWKIEGDSITSI
FT                   NKPYFDLIDGVDEILGELPKDKEILVACAKEGSSQFVAEQIVEATGQDVYYLEGGMKNY
FT                   SEDLQPVKLGDLSNGGELYQFVRLGKGCLSYIAVAKNGDAAIVDTTRMVDQYQAFLDDK
FT                   KATLKHAIDTHLHADHISGARTMRERTGAKYWLPSKDADEVQFNYEAFEDGQELTIGAA
FT                   GEEIQLKAVYSPGHTIGSTSVIIDDQYLVTGDILFVESIGRPDLAGKAEDWVGDLRNSL
FT                   YVTFKNLDQNLKVLPAHFAKFAEVDEHGRVFETLEELFKTNEGLQFEDEAEFRSYVTGN
FT                   LPPQPNSYQEIRQTNMGKIDPEPEEKTEMEIGPNRCAVTE"
     atgagcttaa aagtaatgac tgcaaacgaa ttgggacaga agattattgc acgtgaggat        60
     ctgtttatcc tggacgtgag aaatgaagat gcctatcagg actggaaaat cgaaggtgac       120
     agcattacct caatcaacaa gccgtatttt gatctgattg atggtgtgga tgagatcctc       180
     ggagaacttc caaaagataa agagattttg gttgcctgtg cgaaagaagg ttcttcacag       240
     ttcgtcgcag agcagatcgt ggaagcgaca gggcaggatg tatactatct tgaaggcgga       300
     atgaagaatt attcagagga ccttcagccg gtgaagctcg gtgacctcag taacggcgga       360
     gagctgtatc agttcgtacg tctcggtaaa gggtgcctct cttatatcgc agtggccaag       420
     aacggggatg cagcgatcgt ggatacgacg agaatggttg atcagtacca ggccttcctc       480
     gatgataaaa aagcaacgct caagcatgcc atcgatactc accttcatgc agaccacatt       540
     tccggagcaa gaacgatgcg cgagcgaaca ggcgcaaaat actggcttcc ttcgaaagat       600
     gcggatgaag tccagttcaa ctatgaagcg tttgaagacg gtcaggaatt gacgattggc       660
     gcggcgggcg aagagattca gctgaaggct gtttattcac caggccacac catcggcagt       720
     acttcggtca tcattgacga tcagtatctc gtgacagggg acattctctt cgttgaatcc       780
     atcggccgtc cggaccttgc agggaaagcg gaagactggg ttggcgatct gagaaactcg       840
     ctttacgtga cgtttaagaa ccttgatcag aacctgaaag tgctcccggc tcacttcgcc       900
     aagtttgcgg aagtcgatga gcatggccgt gtctttgaaa cacttgaaga gctgttcaag       960
     acaaacgaag ggctccagtt tgaggatgag gcggaattcc gaagctatgt aacaggaaat      1020
     ctcccgccac agccaaactc ctaccaggaa atccgtcaga ccaacatggg gaaaatcgat      1080
     ccggaaccgg aagaaaaaac ggaaatggaa atcggcccta accgctgcgc tgtaacggaa      1140
     taa                                                                    1143
//

If you have problems or comments...

PBIL Back to PBIL home page