(data stored in ACNUC7421 zone)

EMBL: CP001791.PE428

CP001791.PE428       Location/Qualifiers
FT   CDS_pept        470447..471376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0442"
FT                   /product="ribonuclease Z"
FT                   /EC_number="3.1.26.11"
FT                   /note="TIGRFAM: ribonuclease Z; KEGG: pmr:PMI0252
FT                   ribonuclease Z; PFAM: beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97980"
FT                   /db_xref="GOA:D6XXC3"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR013471"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXC3"
FT                   /inference="protein motif:TFAM:TIGR02651"
FT                   /protein_id="ADH97980.1"
FT                   /translation="MELHMLGTGAGVPTKERNVTAMVMKGVDGKKACWMIDCGEGTQHQ
FT                   ILHAPIKAGAITKVFITHLHGDHLYGLPGFLGSRSFQGADQPLTVYGPSGLRPYIEQSL
FT                   AVSGTHLTYPLTVHEVEEGEIVDDGNWRISCLALDHRMPSFGYRFDEKEQPGRLDRERL
FT                   LKDDIPSGPWLGDLKEQKTVTLPDGRVVDGRDYVTEPVKGRRIVILGDTRPMPAVADFA
FT                   KEADLLVHEATFMAGERETADRFAHSTTLDAAEIARQADVSRLLLTHISARYKAADMAG
FT                   YTEEARSRFPNTKTAADFGVYSLERGDR"
     atggagctgc atatgctcgg caccggtgcc ggtgttccga cgaaggagag aaatgtcact        60
     gcgatggtga tgaaaggtgt ggacggcaaa aaagcatgct ggatgattga ctgcggtgag       120
     gggacccagc atcagatcct gcacgctccg atcaaggcgg gggcgatcac gaaggtgttc       180
     atcactcatc tgcacgggga tcatctatac ggacttccgg gcttcctcgg gagccggtcg       240
     tttcaggggg cggatcagcc tctcacggta tatggtccct caggtctcag gccttatatt       300
     gaacagagcc tcgccgtcag cgggacccat ttgacgtatc cgctgacggt gcatgaagtg       360
     gaggaaggag agattgtgga cgacggcaac tggcgcatca gctgcctcgc cctcgaccac       420
     cgcatgcctt cttttggcta ccggtttgac gaaaaggagc agccgggacg cttggatcgg       480
     gagcgtctgt taaaggacga tatcccttcc ggtccatggc ttggtgacct gaaggaacaa       540
     aaaactgtca cgctccctga cggtcgggtg gtcgatggca gagactatgt cacggaaccg       600
     gtgaaaggac gccgcatcgt tatcttaggt gacacccgcc ccatgccggc agttgccgat       660
     tttgcaaaag aggcggatct gcttgttcat gaggcgacgt ttatggcggg tgagagggag       720
     accgccgacc gcttcgccca ttcgacgacc cttgatgctg cggagattgc ccggcaggcg       780
     gatgtgagcc gcctccttct cacccatatc agtgcccgct ataaggcagc ggatatggcc       840
     ggatatacgg aagaagcccg ctcgcggttt ccgaatacaa aaacagcggc ggacttcggt       900
     gtttattcat tggagcgtgg ggaccggtag                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page