(data stored in ACNUC7421 zone)

EMBL: CP001791.PE429

CP001791.PE429       Location/Qualifiers
FT   CDS_pept        complement(471349..472911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0443"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: tcx:Tcr_1143 diguanylate cyclase;
FT                   SMART: GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97981"
FT                   /db_xref="GOA:D6XXC4"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029150"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXC4"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADH97981.1"
FT                   /translation="MRLLSKNKGLITVLAFVALTWAYANWFVSDNFQKERQRDVQAQMA
FT                   IFQSELESITGTYQEFATYIYHSLINQPEILDIMREAENADDARLDRLRSDAYTLLLNP
FT                   YLQIRQYNFRQLHLHLPDGSSFLRMHAPDEYGDPLYDVRETIAETHRTRNSVSGFEEGK
FT                   IFNGYRYVFPLLADGELIGSGEVSLSLQAAIQILNDIYPTDNTLFILHHDVVDRNIFDD
FT                   YRDNYVSSFISDDYYFDRDAILASPNRDRHDIYANYAVQHQIRTRAEDHLPNHAPFYFT
FT                   IDVDGDDYLVQFVPITNFEETSVGYFITAMHDEGLQALTAQRNREFIYVNGFFGILTVF
FT                   FTTLYYERRKIRHLAHTDQLTGQMNRNAFINHANRLIRLSVKNKTPLSVALLDIDHFKK
FT                   INDTYGHKTGDQALQEIATSIREALDESDLFARWGGEEFVIMMPETREKEAEIRLDAIR
FT                   ATIAGKAFTQVGTITISIGITGARPDRDSLEQLIASADEALYEAKNKGRNRVVLYRSPR
FT                   SNE"
     gtgaggctgc tctcaaagaa taaaggactg atcacagtac tcgcgtttgt cgcactcaca        60
     tgggcgtacg ccaactggtt tgtatcggat aatttccaaa aggaacggca gcgtgacgtc       120
     caagcacaga tggccatttt ccaatcagag cttgaaagca ttaccggcac ctatcaggaa       180
     ttcgcaacct acatttacca cagtctgatc aatcagccgg agatcctcga cattatgcgt       240
     gaagcggaga acgccgacga tgcccgtctc gacaggctta gaagcgatgc ctacaccctg       300
     cttctcaatc catacctgca aatccgacag tataatttca ggcagcttca ccttcacctc       360
     ccggatgggt cgagctttct tcgcatgcac gccccggatg aatacgggga tccgctctat       420
     gacgtgagag agacgattgc cgagacccat cgaacgagaa acagcgtctc aggctttgaa       480
     gagggcaaga tattcaatgg ctaccgctat gtcttcccgc tcctcgcgga tggggagcta       540
     atcggctcag gggaggtttc tctttccttg caggccgcga ttcaaattct caacgatatt       600
     tatccaacgg acaataccct gtttatcttg catcatgacg tcgtcgaccg gaacatcttt       660
     gacgattacc gggataacta cgtttcttct ttcatttccg atgattacta ttttgaccgt       720
     gacgccatac tcgcttcccc gaaccgggac cggcacgata tctatgcaaa ctatgccgtg       780
     cagcatcaga tccggacaag ggccgaggat catttgccga atcacgcgcc tttttacttc       840
     accatcgatg tggacgggga cgattacctg gtccagtttg ttccgattac gaacttcgag       900
     gaaacctcag tcgggtattt tatcaccgcc atgcacgatg agggccttca ggctctcacg       960
     gcacaacgca accgtgaatt catctacgtc aacgggtttt tcggcattct gacggtgttt      1020
     tttacgaccc tctattatga acgaagaaaa atcagacacc ttgcccacac cgatcaactg      1080
     accgggcaaa tgaaccgcaa tgcctttatc aatcatgcaa atcgtctcat caggctgtca      1140
     gtcaagaaca agacaccttt gtccgttgcc cttcttgaca tcgatcactt caaaaaaatc      1200
     aatgacacat acggccataa aaccggcgat caggccctgc aggaaatcgc cacgtcgata      1260
     cgtgaagcgc tcgatgaatc agaccttttc gcccgctggg gcggtgaaga gttcgtcatc      1320
     atgatgccgg aaacccgaga aaaagaagcg gaaatccgcc tcgatgccat tcgggcaacc      1380
     attgctggaa aagcctttac acaggtcggg acgattacaa tcagtatcgg gatcactgga      1440
     gcacgaccgg accgggattc ccttgaacaa ctcattgctt ctgccgatga agcgctctat      1500
     gaagcgaaga acaaaggccg taaccgggtt gtcctctacc ggtccccacg ctccaatgaa      1560
     taa                                                                    1563
//

If you have problems or comments...

PBIL Back to PBIL home page