(data stored in ACNUC7421 zone)

EMBL: CP001791.PE434

CP001791.PE434       Location/Qualifiers
FT   CDS_pept        477088..478470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0448"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97986"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXC9"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADH97986.1"
FT                   /translation="MKKQRMVQAAMAGTLVVLAACGNENVDEAGAENQSQNENDVNNAA
FT                   EEMNEADQEPVTIKWYNWDNDVMAQTSEQYIADFEEEYPHITVESISMVPGDSLGTLQN
FT                   LDILLSSGEKVDVISFPNVDSLYQRAEMGALAPLDEFYDNEGITPNDEYFINPMVNDDY
FT                   YGIQYNATLNFMMLNKDAFDEAGLDIPDASWTWADFEEYAGQLVNKEGDNQRYGAYFHT
FT                   WPLYMNPPAQTLMKHPFLYEDGTTNFADESFPEMFAMRERLETEGITKTYAESLGADLG
FT                   YRTEYFNENASMLLTGSWMIGEAGDTDLNPHDFTTAFAPVPVLNEGDPSEYYMGGNFFG
FT                   IGNTSEYKDEAYLFARHVSTNLSDSRSELPGWKKGDPQPVVERMIDGNEDQIDVDSLMY
FT                   TLFGDDISYLDASQISITYAGELDSILVDGFGMYMLDNEPLDEVQAWMVEEATKVIDSY
FT                   NE"
     atgaaaaaac aaagaatggt acaggctgca atggcaggca cactggttgt tttagccgca        60
     tgcggcaatg agaatgtcga tgaagcggga gcggaaaatc agtctcaaaa tgaaaatgac       120
     gtaaataatg cggctgaaga aatgaacgaa gccgatcaag aaccggtgac aatcaaatgg       180
     tacaactggg acaatgatgt gatggcacaa acgtctgagc agtatattgc tgactttgaa       240
     gaagaatacc cacatatcac agttgaatca atttccatgg taccgggtga ttcactggga       300
     accttgcaaa atcttgatat ccttctttct tcaggagaaa aagttgatgt catttcattt       360
     ccaaatgtcg acagcctcta tcaacgagca gagatgggag ctttggctcc gctcgatgaa       420
     ttttatgaca atgaaggtat cacgccaaat gatgagtatt ttataaatcc aatggtaaat       480
     gacgattact acgggattca gtacaatgcg acactcaact tcatgatgtt aaacaaggat       540
     gcttttgatg aagccggtct tgatattcct gatgcaagct ggacttgggc agattttgaa       600
     gagtatgccg ggcagcttgt caataaagaa ggagataatc agcgatatgg tgcttatttc       660
     catacgtggc cgttatacat gaatcctcct gcacagacgt taatgaagca tccgttcctc       720
     tatgaagatg gaacaacgaa ctttgcagat gagtcgttcc cggaaatgtt tgcaatgaga       780
     gagcgtcttg aaacagaagg gattacaaag acatatgcag agtcactcgg tgcagatctt       840
     ggttaccgta cagagtattt taatgagaac gcctcaatgc tattgaccgg ttcatggatg       900
     attggagaag ccggtgatac ggatctcaat ccgcatgatt tcacaacggc ttttgcacca       960
     gttccggttt taaatgaggg tgatccttct gaatactaca tgggtgggaa tttcttcgga      1020
     attggtaaca ccagtgagta taaagacgaa gcatatctgt ttgcgagaca tgtctcaaca      1080
     aatctgtctg actcacgctc tgagcttccg ggttggaaaa aaggagaccc acagccggtt      1140
     gtagaacgga tgattgatgg taatgaagat caaattgatg ttgattctct gatgtataca      1200
     ctgttcgggg atgatatttc ttatcttgat gcttcgcaga tcagcattac gtatgcagga      1260
     gaactcgatt cgattctagt tgacggtttt gggatgtata tgctggataa tgaaccgctt      1320
     gatgaagtgc aggcttggat ggtagaggaa gcaacaaagg ttattgacag ctacaacgaa      1380
     taa                                                                    1383
//

If you have problems or comments...

PBIL Back to PBIL home page