(data stored in ACNUC7421 zone)

EMBL: CP001791.PE437

CP001791.PE437       Location/Qualifiers
FT   CDS_pept        481867..483009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0451"
FT                   /product="glycosyl hydrolase family 88"
FT                   /note="PFAM: glycosyl hydrolase family 88; KEGG:
FT                   rlg:Rleg_5051 glycosyl hydrolase family 88"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97989"
FT                   /db_xref="GOA:D6XXD2"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR010905"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXD2"
FT                   /inference="protein motif:PFAM:PF07470"
FT                   /protein_id="ADH97989.1"
FT                   /translation="MTPSDIKKLIIKRTSRNLKKTGGLYPHVGDDGIYRLIKNEDWTNG
FT                   FWSGVLWECYEGSGDSVFLNAAKEETKSFEKRMTDNVVLDHHDLGFLYSLSSKADWIIT
FT                   GDESARLLSIQAADRLLQRWRSVGGYIQAWGNKGDKTEGGRMIIDCLLNLPLLFWATKT
FT                   TGNSKYEVVARQQAEQTLRYLVRGDGSSYHTFIFNQKTGEPVGGTTHQGSSNGSTWSRG
FT                   QAWGVYGFALLYRFTKEERYLVKAKEMLDYFLRHQPEQGLISWDFNASQKEEHYTDSSA
FT                   MAIALCGMLELREWTDPSESERLDTCINLFIQNLADYALIKEDDPEKVTGLLHHASYYV
FT                   RGGDVPDGSVIWGDYFFTEAIMRMTDQRTGYWYERSSFHE"
     atgacaccct ctgacataaa aaaattaatc attaagcgaa cgtcacgtaa tctgaaaaaa        60
     acgggagggc tttaccctca tgttggtgat gacggcatct accgcctcat caaaaatgag       120
     gattggacaa atggattttg gtcaggtgtt ttatgggagt gttacgaggg ttcaggggac       180
     tctgtttttt tgaatgcagc aaaagaagaa acaaagtcct ttgaaaagag aatgactgac       240
     aacgtcgttc tcgatcacca tgatctcgga tttctttatt cactctcttc taaggctgac       300
     tggatcataa ctggagacga atcggcacga ttactcagta ttcaggcagc tgatcgactg       360
     ttgcagcgct ggcgttctgt ggggggatat attcaggctt ggggaaataa gggagataaa       420
     acagaaggag gacgcatgat tatcgactgt ctcctcaatc tgccgctgct attctgggcc       480
     acaaaaacaa caggaaacag caagtatgaa gtggtggcaa gacaacaggc agaacagact       540
     cttcgctatc tggttcgtgg tgatggcagt tcctatcata cgtttatctt taatcagaaa       600
     acgggtgaac cagttggtgg aacaacacat cagggaagct ccaacggttc gacctggtcg       660
     agaggccagg cctggggtgt atacggattt gcacttttat accggtttac gaaagaggag       720
     cggtatctcg taaaggcaaa ggaaatgctt gattattttc ttcggcatca gcctgaacag       780
     ggtttaattt catgggattt taacgcgtcg caaaaggaag aacattacac cgacagttca       840
     gcgatggcga ttgctttgtg cggaatgctg gagctaaggg aatggactga cccttcagag       900
     tcagaaaggc tggatacctg catcaatcta tttattcaaa atctggctga ttatgcactg       960
     attaaagagg acgatccaga aaaggtgaca ggtcttcttc atcacgcttc ttactacgtc      1020
     agaggaggag atgtgcctga tggttctgtc atctgggggg attatttttt taccgaagca      1080
     atcatgagaa tgacggatca acggacaggc tactggtatg agaggagcag ttttcatgaa      1140
     taa                                                                    1143
//

If you have problems or comments...

PBIL Back to PBIL home page