(data stored in ACNUC7421 zone)

EMBL: CP001791.PE438

CP001791.PE438       Location/Qualifiers
FT   CDS_pept        483002..483652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0452"
FT                   /product="protein of unknown function DUF624"
FT                   /note="PFAM: protein of unknown function DUF624"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97990"
FT                   /db_xref="GOA:D6XXD3"
FT                   /db_xref="InterPro:IPR006938"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXD3"
FT                   /inference="protein motif:PFAM:PF04854"
FT                   /protein_id="ADH97990.1"
FT                   /translation="MNNWIMNRLEAMGNWVFALAYVNVLWLLFTLAGAVVFTITPATVA
FT                   MMTCIRRWKEDPSYTIRFDEYRKLFKSEFREASRLNLFLLPVLIMLILNTGLLLHSQME
FT                   IPLILMVMYIISVVFSAVMFMHIFTVYALLNKRSLQAVTASVVFGFSHPFHSMMSFLLI
FT                   VLVFLLIFSTSGLAMFFGISLISYVLFRRNCMLYEKDLSDDEEPRPHTEAVSL"
     atgaataatt ggatcatgaa tcgtttggaa gcaatgggga attgggtgtt cgcgcttgcg        60
     tatgtaaatg ttctttggct tctctttact cttgcaggcg cagtcgtatt tacaattacc       120
     cctgcaactg tcgcgatgat gacatgcata cgaagatgga aggaagatcc ttcatatacg       180
     atccgctttg atgaatatag aaaactgttt aaatcagagt tcagggaagc aagtcgtttg       240
     aatctgtttc tgttgccggt gctgattatg cttatattga atacagggtt gttgcttcat       300
     tcacaaatgg aaattcctct tatacttatg gtgatgtata tcatttccgt cgtgttttca       360
     gctgtcatgt ttatgcatat ttttacggtt tatgctctgt tgaacaagcg gtctttgcaa       420
     gccgtaactg catctgttgt atttggtttc tcacatccgt tccattcaat gatgtcgttt       480
     cttctgatcg tcctggtgtt ccttttgata ttcagtacat caggtctggc catgtttttt       540
     ggcatcagtc ttatcagtta tgtactgttt cgcagaaact gcatgttata tgaaaaagac       600
     ctctcagacg atgaagagcc gcgaccccat acggaggcgg tcagtttatg a                651
//

If you have problems or comments...

PBIL Back to PBIL home page