(data stored in ACNUC7421 zone)

EMBL: CP001791.PE440

CP001791.PE440       Location/Qualifiers
FT   CDS_pept        483804..485270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0454"
FT                   /product="Heparinase II/III family protein"
FT                   /note="PFAM: Heparinase II/III family protein; KEGG:
FT                   sat:SYN_02676 putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97992"
FT                   /db_xref="GOA:D6XXD5"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR012480"
FT                   /db_xref="InterPro:IPR031680"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXD5"
FT                   /inference="protein motif:PFAM:PF07940"
FT                   /protein_id="ADH97992.1"
FT                   /translation="MEPCSDVVTLPLPIDWTYCHNDDLEWTYMLNRMKFMEDLAFASLY
FT                   KGDNRYRDSFEFYLEDWMRQHGDGETAVVWRKIDCALRIVHLIRAKAFLCACQSWNNRC
FT                   ESLFSRLAGQTSEYLLRSFTSVDAQSNWGFIETNALIQLAIMQTGKAGFAETVKEAMRR
FT                   LELMVTLQIGGDGVHLEQSPGYHHEVLRNLFECVHLSELNGICVPADVKEGLKKMFKAS
FT                   SRMIRPDGSQPQFGDSDILDIRPFMALAAYRYHDESFVPPLLGTVTFDTLWYTAGDLFC
FT                   HQERYIKDSNDPLRDWLEDSGLQIARSGWERHSDYVCMNAGEMGLSAHGHDDLTHFEWL
FT                   VDGVPFVISTGRGTYRESSLRKQLKTAKGHNMVLIDDKMPSTYGDTWSWLQEAAPVNAK
FT                   MTSAKGYTYMRAAHDGYLSLQSGGLITRELILTPRGSLVVIDSILGGGSHHYQQAFHVS
FT                   ERFTVWKPNKQTLRFNYASLSIKMQQCTPG"
     atggagccat gctctgacgt tgtgactctt cccttgccaa tcgactggac atactgtcac        60
     aacgatgatc ttgaatggac gtatatgctg aatcggatga agttcatgga ggatttggca       120
     tttgcttcat tatacaaagg agacaatcgc tacagagact catttgaatt ctatttggag       180
     gactggatga ggcaacacgg ggatggggag acagcggttg tctggcgaaa aatagattgc       240
     gcactccgta ttgtccactt aattcgtgcc aaagcgtttc tttgtgcctg tcagtcatgg       300
     aataaccgtt gtgagagtct gttcagccgg cttgcaggtc aaacttctga atatctgctc       360
     aggtcattta cgtcagtaga cgcccaaagc aattggggct ttattgagac gaatgcactg       420
     attcaattgg caatcatgca gactggaaaa gccggtttcg cagagacagt taaggaagca       480
     atgagacgcc tggagctgat ggtaacgtta caaatcggtg gagatggcgt tcacctggag       540
     cagtcaccgg gctatcatca tgaagtgttg cggaatttgt ttgaatgtgt ccatctatca       600
     gaattaaatg gtatctgtgt accggctgac gtaaaagaag gactcaagaa gatgtttaaa       660
     gcctcatctc ggatgatccg tccagacgga tctcagccgc agtttggaga cagcgatatc       720
     ctggatatca gaccattcat ggcccttgca gcttatcggt atcatgatga atcatttgtt       780
     cccccgttgt tgggtacagt gacgtttgac acgctttggt atactgccgg agacctgttc       840
     tgccaccaag agcggtatat aaaggattcg aatgaccctc ttagggattg gcttgaagac       900
     tcaggtctgc aaattgcaag aagcggatgg gaacgtcaca gtgactatgt ttgtatgaac       960
     gcaggggaga tgggactatc cgctcacggg catgatgatc tgacacattt tgaatggctg      1020
     gttgacggtg tcccgtttgt catcagtacc ggaagaggga catatcgtga atcctctttg      1080
     cgcaagcaat tgaagacggc gaagggtcac aatatggtct taattgatga taaaatgcct      1140
     tcgacttatg gtgacacatg gtcatggctt caggaagcgg ccccggttaa cgcgaaaatg      1200
     acatcagcta aagggtatac gtatatgcgt gcagcccatg acggatatct gtctttacaa      1260
     tcaggtggac tcattaccag ggaactgatc ttgacaccga gaggaagcct tgttgtgatt      1320
     gattcaattc ttggtggtgg atctcatcat tatcaacagg cgtttcatgt gagtgaacgg      1380
     ttcactgtat ggaagccaaa taagcagact ctcagattca attacgcttc attatcaata      1440
     aaaatgcagc aatgcacccc cggttga                                          1467
//

If you have problems or comments...

PBIL Back to PBIL home page