(data stored in ACNUC7421 zone)

EMBL: CP001791.PE443

CP001791.PE443       Location/Qualifiers
FT   CDS_pept        488066..488698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0457"
FT                   /product="2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase"
FT                   /note="KEGG: scl:sce5154 KDPG and KHG aldolase; TIGRFAM:
FT                   2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase; PFAM: KDPG and
FT                   KHG aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97995"
FT                   /db_xref="GOA:D6XXD8"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXD8"
FT                   /inference="protein motif:TFAM:TIGR01182"
FT                   /protein_id="ADH97995.1"
FT                   /translation="MKTITQDLMKHKLVAIIRGTGREEGYPTASAMIRGGFRFLEVTLN
FT                   TEGAMTVIEEVNDVHGGDVYVGAGTVMNRNMAEDAVSAGARFLVSPHFDHDVMAFAYEA
FT                   EIPYWPGSLTPTEIISAFESGADVVKVFPAGVMGSDYLKALSGPFPDIPLMVTGGVHPG
FT                   NIRNYFEAGATAAGIGGDLCHLPSIRAGQYESIEAKAKTYVNAMKER"
     atgaaaacaa ttactcaaga tttgatgaag cataaactgg ttgccatcat aagaggaacc        60
     ggacgggaag aaggatatcc gacggcaagt gcgatgattc gaggagggtt tcgatttctt       120
     gaggtgacat taaatacaga aggtgcaatg actgttattg aagaggtgaa tgacgtccat       180
     gggggtgatg tctatgtggg agcagggacg gtcatgaatc ggaatatggc ggaagatgct       240
     gtttcggcag gggcgcgatt tcttgtttcg ccgcactttg accatgatgt tatggcgttt       300
     gcatatgaag cggaaatacc ctattggccg ggaagtttaa cgcctacaga aattatcagt       360
     gcttttgagt caggcgccga tgtcgtgaaa gttttcccgg caggagttat gggttctgat       420
     tatctgaagg cgctgtcggg acctttcccg gatattccgc ttatggtaac tggaggggtt       480
     caccccggga acatccgtaa ctatttcgag gccggggcaa ctgcagccgg cattgggggc       540
     gatttatgtc atctcccttc aattcgtgca gggcagtatg aatcaataga agcaaaagca       600
     aagacatatg tgaatgcgat gaaggaaagg tga                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page