(data stored in ACNUC7421 zone)

EMBL: CP001791.PE445

CP001791.PE445       Location/Qualifiers
FT   CDS_pept        complement(489759..490514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0459"
FT                   /product="2-deoxy-D-gluconate 3-dehydrogenase"
FT                   /note="KEGG: xcv:XCV0153 short chain dehydrogenase;
FT                   TIGRFAM: 2-deoxy-D-gluconate 3-dehydrogenase; PFAM:
FT                   short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97997"
FT                   /db_xref="GOA:D6XXE0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011286"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXE0"
FT                   /inference="protein motif:TFAM:TIGR01832"
FT                   /protein_id="ADH97997.1"
FT                   /translation="MQRLFSLEGKTAVVTGSARGLGQGMAVGLAEAGADIIGISFSEQQ
FT                   ETKKLVENLGRRFFDIEKDLSIQSDIQGIVEEAINKTGSVDILVNNAGTIKRAEAEHFS
FT                   DEDWDSVIDLNLNSVFRLSKGFGQHMIARGSGKIINIASMLSFQGGLRVPSYTASKHAV
FT                   AGITKSLANEWAAKGVQVNAIAPGYFATDNTAQIRSDESRNAFITSRIPKAEWGTPADL
FT                   QGPVVFLASDASNYMTGHIMAVDGGWLSS"
     atgcaacgtt tattttcact tgaaggaaaa acagccgtcg tgacaggttc agcaagaggt        60
     cttggtcagg gaatggcagt tgggctggca gaagccggag ctgatattat cggaatcagt       120
     ttcagtgaac agcaagaaac gaaaaaactc gtcgaaaatc tcggcagacg tttttttgat       180
     attgaaaaag acctgagcat tcaaagtgac atccagggaa tcgtagaaga agcgataaat       240
     aaaacaggtt ctgtcgatat tctcgtcaac aatgcaggca ccatcaaaag ggccgaagct       300
     gaacatttca gtgacgagga ttgggacagt gtgattgacc tgaatttgaa cagcgtcttc       360
     cgtctgtcaa aaggatttgg gcagcatatg atagccagag gatcaggaaa aatcatcaac       420
     atcgcttcca tgctctcttt tcaaggagga ctgcgggtgc cttcctacac ggcaagcaag       480
     catgccgttg ccggcataac gaaatccctt gccaatgaat gggcagcaaa aggcgttcag       540
     gttaatgcca tcgcaccggg ctattttgct acagacaaca ctgcgcagat ccggtccgat       600
     gaatcacgca acgctttcat tacctcaaga attccaaagg ccgaatgggg aacccctgct       660
     gatctgcaag gtcccgttgt atttcttgca tcagatgcat caaactatat gaccggacac       720
     atcatggccg ttgatggtgg ctggctcagt tcataa                                 756
//

If you have problems or comments...

PBIL Back to PBIL home page