(data stored in ACNUC7421 zone)

EMBL: CP001791.PE446

CP001791.PE446       Location/Qualifiers
FT   CDS_pept        complement(490525..491355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0460"
FT                   /product="4-deoxy-L-threo-5-hexosulose-uronate
FT                   ketol-isomerase"
FT                   /EC_number="5.3.1.17"
FT                   /note="KEGG: rlt:Rleg2_5662
FT                   4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase; PFAM:
FT                   5-keto 4-deoxyuronate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97998"
FT                   /db_xref="GOA:D6XXE1"
FT                   /db_xref="InterPro:IPR007045"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR021120"
FT                   /db_xref="InterPro:IPR027449"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXE1"
FT                   /inference="protein motif:PRIAM:5.3.1.17"
FT                   /protein_id="ADH97998.1"
FT                   /translation="MEIRHATNPTDFKLYTTDRLRSDFLMENLFIEGELNLVYSHYDRV
FT                   ITGGVVPKEEEIKLPIIEQMKTEYFLERREMGIVNIGEPALVNVEGETYELNKRDCLYI
FT                   GKGNQHVSFKSKNPDNPSKLYFVSVNAHTPYPVTLMPIKDATPVKLGSNAESNSRTIYK
FT                   YIHSDGIQSCQLMMGMTLLEPNNMWNTMPAHLHDRRMEVYLYFDMDASSRVFHFMGQPH
FT                   ETRHLVVQNEQVVLSPPWSIHSGVGTNNYTFIWAMAGDNYTFTDMDFIPMEDLR"
     atggaaatac gtcatgctac gaaccctaca gattttaagc tttacaccac tgatcgactt        60
     cgcagcgatt ttcttatgga aaacctcttt attgaagggg agctcaatct tgtatactcc       120
     cattatgatc gggtgatcac tggtggagtc gtgccaaaag aagaggagat caaactcccg       180
     attatcgaac aaatgaaaac ggagtacttc ttggaacgca gagagatggg catcgtcaac       240
     ataggcgaac cggctttggt gaatgttgaa ggagaaacgt acgaactgaa caaacgggac       300
     tgcctgtata tcggaaaagg aaatcaacat gtttctttca agagtaaaaa tcctgacaac       360
     ccgtcaaagc tttattttgt atcagttaat gcgcatacac catatcctgt tactctgatg       420
     ccaatcaaag atgctactcc ggtcaaactt ggcagtaacg ccgagtcaaa cagccgcacc       480
     atctataaat atattcattc agacggcata caaagttgcc aactgatgat gggcatgacc       540
     ttgcttgaac caaacaatat gtggaatacc atgcctgccc accttcacga tcggcgtatg       600
     gaagtgtacc tctattttga tatggatgca tcctccaggg tgtttcattt catgggacag       660
     cctcatgaaa caagacatct tgttgtccaa aatgaacagg tcgttctctc tccgccatgg       720
     tcaatccact ctggtgtagg tacgaataat tacacattca tttgggcaat ggcaggagac       780
     aattatacct ttactgacat ggattttatc ccaatggaag acttacgata g                831
//

If you have problems or comments...

PBIL Back to PBIL home page