(data stored in ACNUC7421 zone)

EMBL: CP001791.PE447

CP001791.PE447       Location/Qualifiers
FT   CDS_pept        complement(491579..492229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0461"
FT                   /product="channel protein, hemolysin III family"
FT                   /note="KEGG: dvl:Dvul_0099 hemolysin III family channel
FT                   protein; TIGRFAM: channel protein, hemolysin III family;
FT                   PFAM: Hly-III family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97999"
FT                   /db_xref="GOA:D6XXE2"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="InterPro:IPR005744"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXE2"
FT                   /inference="protein motif:TFAM:TIGR01065"
FT                   /protein_id="ADH97999.1"
FT                   /translation="MHTFIREPVNSLTHWAGAVLSLIGLVAMLFRSSEAGFGTLEIAAV
FT                   TVFGLSLILLYTASATYHMIIASDSVIAFFRRLDHSMIYILIAGTYTPFCLIAMQGPAG
FT                   WALFGIVTAMAIAGVTFKLIWFHSPRWLSTGIYIGMGWLIVFFVVPLTSVIDPTGLVLL
FT                   VAGGVLYTIGGVLYAIKPDWSILNSIGFHEVFHLFILFGSLAHYFSVYFFVIG"
     atgcacacct ttattcgtga acccgttaac agcctgacac attgggccgg tgctgttctg        60
     tccctgatcg gcctcgtcgc catgctgttc cgttcttcag aagccggctt cgggaccctt       120
     gaaatcgccg ctgtgactgt gttcggcctc agtctgatcc tcctgtatac cgcatctgcc       180
     acctatcata tgattattgc aagcgacagt gtcatcgcct ttttcagacg gctcgatcat       240
     tcgatgattt atattctgat cgcaggcacg tacacccctt tttgcctcat tgccatgcag       300
     gggcccgcag gctgggcact cttcggcatt gtcacggcca tggccatcgc cggtgtaacc       360
     ttcaagctga tctggttcca ctctccgcgc tggctctcca ctggcatcta catcggcatg       420
     ggctggctca tcgtgttctt tgtcgtgccg cttacgtccg tcattgatcc aaccggactc       480
     gtcctcctcg ttgccggcgg tgtgctttat acgatcggcg gggtcctcta cgcgatcaag       540
     ccggactggt cgatcctgaa ctctatcggc tttcacgaag tctttcacct cttcatcctc       600
     tttggaagcc tcgctcacta cttcagcgtc tattttttcg tcatcggatg a                651
//

If you have problems or comments...

PBIL Back to PBIL home page