(data stored in ACNUC7421 zone)

EMBL: CP001791.PE448

CP001791.PE448       Location/Qualifiers
FT   CDS_pept        492353..492913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0462"
FT                   /product="Domain of unknown function DUF1836"
FT                   /note="PFAM: Domain of unknown function DUF1836; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98000"
FT                   /db_xref="InterPro:IPR014975"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXE3"
FT                   /inference="protein motif:PFAM:PF08876"
FT                   /protein_id="ADH98000.1"
FT                   /translation="MTKEPSDSLGRMIRTEDIPTIDLYMDQIIQLFEQTFADTKRDKSD
FT                   KIMTKTMINNYAKGGLLFPIQKKRYSREHIMLIALIYELKGILSVHDIKTALRRISREG
FT                   SPKEMNDVYSRYLKLADENLQLFKDEISKHKKRVESHILEMETDEEVQDVLMILACVNM
FT                   SNLYRRMAEELIDDLADPDEDSL"
     atgacaaaag aaccttcaga ctctttgggc aggatgattc gcacagaaga catcccgaca        60
     attgatctct atatggatca gatcatccaa ttatttgagc aaacttttgc ggatacaaaa       120
     agggataaaa gtgataaaat tatgacaaag acgatgatta ataactatgc aaaaggaggc       180
     ttgcttttcc cgattcagaa gaaacggtac tcaagggaac atataatgct catcgcactg       240
     atctatgaac tgaaaggcat cctgtctgtc cacgatatca aaacggcatt aagacggatt       300
     tccagggaag gttcgccaaa agagatgaat gacgtttaca gccgatatct caagctggct       360
     gatgagaacc ttcagttgtt caaagatgaa atcagtaagc ataaaaagcg ggtggagagc       420
     catatcttgg agatggagac ggatgaggag gttcaggatg ttctgatgat tctcgcatgc       480
     gtgaacatga gcaatctgta ccgccggatg gccgaagaac tgatcgatga tctggctgat       540
     ccggatgagg attccctgta a                                                 561
//

If you have problems or comments...

PBIL Back to PBIL home page