(data stored in ACNUC7421 zone)

EMBL: CP001791.PE45

CP001791.PE45        Location/Qualifiers
FT   CDS_pept        56059..56649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0046"
FT                   /product="primase/topoisomerase like protein"
FT                   /note="TIGRFAM: primase/topoisomerase like protein; KEGG:
FT                   predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97597"
FT                   /db_xref="GOA:D6XV39"
FT                   /db_xref="InterPro:IPR004466"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR025156"
FT                   /db_xref="InterPro:IPR034141"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV39"
FT                   /inference="protein motif:TFAM:TIGR00334"
FT                   /protein_id="ADH97597.1"
FT                   /translation="MERERIGPMIVVEGKNDSLTLKRWFDCDTIETNGSAVPDAVLERI
FT                   ALALGRRGVIVFTDPDYPGDQIRKIIDREVPGCSHAFLPKADAIDVRKGKVGIEHAGYR
FT                   ALQEALASVRRPGDDAQEDPSFETVPLRRLTEAGLLDGPDARSRRRILGELLGIGYNNS
FT                   KQLPKRLHQFRISLREFEEAQAAMIKEMEQFER"
     atggagagag aacggatcgg cccgatgatt gtcgtggaag gcaagaatga ttccctgacg        60
     ctgaagcgct ggtttgactg tgacacaatc gaaacgaacg gatcggccgt tccggatgcg       120
     gtccttgaac ggattgccct cgctctcgga agacgcggcg tgatcgtctt taccgacccg       180
     gactaccccg gtgatcagat ccgtaagatc attgaccggg aggtgccggg ctgttcccat       240
     gcgtttttgc ccaaggccga cgccatcgat gtgaggaaag gcaaagtcgg catcgaacac       300
     gccggttacc gcgccctgca ggaagccctc gcttcggtaa gacgtccggg cgatgatgcg       360
     caggaggatc cgtcctttga aacggtgcct cttcgccggc ttacggaggc cggtctcctc       420
     gacggtccgg atgcaagaag ccgcaggcgg atcctcggtg agctgctcgg tatcggctac       480
     aataacagta aacagctgcc caagcgtctt caccagttcc gtatttccct tcgtgaattt       540
     gaggaagcgc aggcagccat gataaaggag atggagcaat ttgagcgata g                591
//

If you have problems or comments...

PBIL Back to PBIL home page