(data stored in ACNUC7421 zone)

EMBL: CP001791.PE450

CP001791.PE450       Location/Qualifiers
FT   CDS_pept        complement(493432..494040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0464"
FT                   /product="protein of unknown function UPF0126"
FT                   /note="PFAM: protein of unknown function UPF0126; KEGG:
FT                   ppd:Ppro_2916 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98002"
FT                   /db_xref="GOA:D6XXE5"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXE5"
FT                   /inference="protein motif:PFAM:PF03458"
FT                   /protein_id="ADH98002.1"
FT                   /translation="MWEILNIIGTIAFALSGVLVALEERYDLMGVYILGFITAFGGGAI
FT                   RNLLIGIPVTELWNQGALFTLAFLVMTLAFFFPNILNWTLQKRGVFFDAIGLGTFSAQG
FT                   ALFAASMGLPISAAIAAAALTGAGGGMVRDVLAGRKPMFLHKEIYIAWTLIPGLLIGSG
FT                   LVTSDIGAFLIVSAVVLLRLGSVQKQWHLPYQSFQPLTK"
     atgtgggaaa ttctcaatat catcggcaca attgcatttg ccctcagtgg tgtgctcgtc        60
     gcacttgaag agcgctacga cctgatgggc gtttatatac tcggctttat taccgccttt       120
     ggcggcggtg cgatccgtaa tctcctgatc ggcatccccg tcaccgaatt gtggaatcag       180
     ggggccctat tcacgctcgc ctttctcgtg atgaccctgg cctttttctt cccgaacatc       240
     ctcaactgga cactgcaaaa gcgcggtgta ttctttgacg ccatcggact cggtaccttt       300
     tccgcacagg gcgcgctgtt cgccgcatcg atggggctgc cgatcagtgc cgcgattgcc       360
     gcagccgctt taacgggtgc cgggggcggg atggtgcgcg acgttttggc cgggcgcaaa       420
     ccgatgtttt tacacaaaga gatctacatc gcctggacgc tgatcccggg gcttctgatc       480
     ggatcaggcc ttgtcaccag tgacatcggg gcctttctta tcgtctcagc cgttgtcctt       540
     ttgcggctcg gatcggttca gaaacagtgg catctgccgt atcagtcctt tcagccactg       600
     acgaagtaa                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page