(data stored in ACNUC7421 zone)

EMBL: CP001791.PE452

CP001791.PE452       Location/Qualifiers
FT   CDS_pept        495158..495565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0466"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: ara:Arad_4048 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98004"
FT                   /db_xref="GOA:D6XXE7"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXE7"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ADH98004.1"
FT                   /translation="MTIRGIAHMAITVRDMEKSLAFYCDQLGFDHAFQVKDEKGNPWIE
FT                   YVKVAPKQYIELFHGGNERPEEPDKAIGFHHVCLLVESVADTAKALEDQGVPLTVQPKR
FT                   GLGKNWQCWVNDPDGNRIEFLEPDGDSPHNQ"
     atgacgatca gagggatcgc acatatggcc ataacggtca gggatatgga gaagagcctt        60
     gccttttact gcgatcagct cggctttgac catgcctttc aggtgaagga tgagaaaggg       120
     aacccgtgga ttgaatatgt gaaggttgcg ccgaagcagt atatcgagct ctttcacggc       180
     gggaacgagc gaccggaaga gccggacaaa gcgatcgggt ttcaccatgt ctgcctgctt       240
     gttgagagcg tggcagacac ggcaaaggcg ctcgaagatc agggcgttcc gttaacggtt       300
     cagccgaaac gcggcctcgg gaagaactgg cagtgctggg tcaatgaccc cgatggcaac       360
     cgtatcgagt ttcttgaacc cgatggggat tcgccgcata accaataa                    408
//

If you have problems or comments...

PBIL Back to PBIL home page