(data stored in ACNUC7421 zone)

EMBL: CP001791.PE454

CP001791.PE454       Location/Qualifiers
FT   CDS_pept        complement(497053..497715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0468"
FT                   /product="SNARE associated Golgi protein-related protein"
FT                   /note="PFAM: SNARE associated Golgi protein; KEGG:
FT                   wsu:WS0198 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98006"
FT                   /db_xref="GOA:D6XXE9"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXE9"
FT                   /inference="protein motif:PFAM:PF09335"
FT                   /protein_id="ADH98006.1"
FT                   /translation="MNRWLTIALVTAVIGGLLWFSRSYLDVSPEEIRNWILGFGTLAPI
FT                   LFITLYALRPIILFPASVMSLAGGLAFGALWGTVIIVIGATLSAAIAYLIGGKLGSRLI
FT                   KVKEGGKTATIQKQMAHNGFVYVLIFRFIPVINFDAISYIAATAGVKFRAFITATFIGI
FT                   IPGTFAYAFLGSSFVTLNPWQIAAAVAIFLVFMIVPILLRKKTVRQNRPGRRRRECA"
     atgaacagat ggctgaccat cgcacttgta accgcagtaa taggaggact gctctggttc        60
     tcccgctcat acctcgatgt atcaccggaa gagatccgca actggattct cggattcggg       120
     acattggcac cgattctgtt tattacgctc tatgccctcc gtccgatcat cctcttccct       180
     gcatccgtca tgagtctcgc aggcggcctg gccttcggtg ccctttgggg aacggtcatc       240
     atcgtcatcg gagccaccct gtccgcagcc atcgcctacc tcatcggcgg gaaactcggc       300
     tcacggctga tcaaagtcaa agagggtggc aaaaccgcga ccatccaaaa gcaaatggcc       360
     cacaacggct ttgtctacgt cctgatcttc cgctttattc cggtgatcaa tttcgacgcc       420
     atcagctaca tcgccgccac ggcaggcgtc aaattccggg cctttatcac cgccacgttc       480
     atcgggatca ttccgggtac ctttgcctat gcctttctcg gatcgagctt tgtgacgctt       540
     aatccctggc agatcgcagc cgccgtcgcc atctttctcg tctttatgat tgtcccgatc       600
     ctgctcagaa aaaaaactgt ccggcaaaat cggcctggac gacgaaggag agaatgtgca       660
     tga                                                                     663
//

If you have problems or comments...

PBIL Back to PBIL home page