(data stored in ACNUC7421 zone)

EMBL: CP001791.PE455

CP001791.PE455       Location/Qualifiers
FT   CDS_pept        complement(497746..498000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0469"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98007"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXF0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH98007.1"
FT                   /translation="MGLIQQAAEQAGIATASVTHLPDLTEKVSVPRALHIKFPLGRTFG
FT                   QAGRSDLQEKITVDLLEAVQNRTEDDEKIQKLPYRWRRD"
     gtgggattga tccagcaggc agcggaacag gccggcatcg caacggcctc tgtgacgcac        60
     ttgcctgatt tgaccgaaaa agtgtccgta ccccgggcgc tgcacatcaa gttccccctc       120
     ggccgcacgt tcggccaggc cgggcgcagc gacctccagg agaagatcac cgtcgatctc       180
     cttgaggccg ttcagaacag aacagaagac gacgagaaga ttcaaaaatt gccataccgc       240
     tggcgccgag actga                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page