(data stored in ACNUC7421 zone)

EMBL: CP001791.PE462

CP001791.PE462       Location/Qualifiers
FT   CDS_pept        501752..502738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0476"
FT                   /product="Helix-turn-helix type 11 domain protein"
FT                   /note="PFAM: Helix-turn-helix type 11 domain protein;
FT                   regulatory protein DeoR; KEGG: gme:Gmet_3086
FT                   transcriptional regulator, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98014"
FT                   /db_xref="GOA:D6XXF7"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR028349"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXF7"
FT                   /inference="protein motif:PFAM:PF08279"
FT                   /protein_id="ADH98014.1"
FT                   /translation="MSTSKFSRPERLFYIMQFLSNHDTVNAGELADHCQATKRTIYRDI
FT                   HFLQSQGHEIQTQGREGYKLLIPNMQVRSKLTEDEWLSLTLYPLLSSGIASSDHPYHRH
FT                   YKTGLEKVMRLASGGAPNPAFAERIRLHARTQDTFQAKVMPAIITAISDNRCIDVRYYA
FT                   MHRSEWSERRLEPYYLVPREGHLYLVAFCRLRNDIRVFRLNRFEDVHVTDAPFTIPQDF
FT                   SIDAFLKKRWSIMEEEEPVDITVRFSPDAARYVDEEDFYVETKKYNETDGTLTLTVTVG
FT                   SRKEFLRWMRSFGPDAEVLSPASLRQALAAEYRHMLGMYEGDDERLW"
     gtgagcactt caaagttcag cagaccggaa cggctctttt acatcatgca atttttatcc        60
     aatcacgata cggtgaacgc cggtgaactg gcggatcatt gtcaggcgac aaagcgcacc       120
     atctaccgcg acattcactt cctgcagtcg caggggcatg agattcagac ccaggggcgg       180
     gaaggctaca agctgttaat cccgaacatg caggtcagaa gcaagctcac cgaagacgag       240
     tggctgtctc tgacgctcta tcccctgctt tcttcgggga ttgcctcttc ggatcatccg       300
     tatcaccgcc actacaagac cggccttgaa aaagtgatgc gactcgcgtc agggggagca       360
     ccgaaccccg catttgccga gcggatccgc ctccatgcga ggacgcagga cacctttcag       420
     gcgaaggtca tgccagcgat catcacggcg atcagtgaca accgctgcat cgatgtcagg       480
     tactacgcca tgcaccgctc ggaatggtcg gagcggcgtc tggagccata ctatcttgtg       540
     ccaagagaag ggcatcttta cctcgttgcc ttctgccggc ttcgaaacga tatccgcgtg       600
     ttcaggctga accgttttga agacgtgcat gtcacggacg cgccgtttac gattccgcag       660
     gacttctcca tcgatgcatt tctgaagaag cgctggtcga tcatggagga agaggaaccg       720
     gtggacatca ccgtccgctt ttcgccggat gcggcccgct atgtggatga agaggacttc       780
     tatgtggaga cgaaaaaata caatgaaacc gacgggacat tgacgctgac ggtcacggtc       840
     gggagccgga aggaattcct tcgctggatg cgctcgttcg gccctgatgc agaagtgctc       900
     tctccggctt cgctccggca ggcgctcgca gcggaatacc ggcatatgct tggcatgtat       960
     gagggagatg acgaacggct atggtag                                           987
//

If you have problems or comments...

PBIL Back to PBIL home page