(data stored in ACNUC7421 zone)

EMBL: CP001791.PE464

CP001791.PE464       Location/Qualifiers
FT   CDS_pept        503472..504113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0478"
FT                   /product="futalosine nucleosidase"
FT                   /note="KEGG: dde:Dde_3188 hypothetical protein; TIGRFAM:
FT                   futalosine nucleosidase; PFAM: purine or other
FT                   phosphorylase family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98016"
FT                   /db_xref="GOA:D6XXF9"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR019963"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXF9"
FT                   /inference="protein motif:TFAM:TIGR03664"
FT                   /protein_id="ADH98016.1"
FT                   /translation="MKQILIVTSVDKERQAVEAGLKGDPRFLTGLCGVGPVEAAVRTMK
FT                   LLSTCSSSVEAVLNLGVAGGIPGKAAVGEAVLGTKTVQADLGFEQADGSFEAIEALGFT
FT                   VSERDANSDLISRVREALRENVHEGPIVTQSTVTGTKASLETLLQRVPDAMAEGMEGFA
FT                   VHSAAEAYGIPALELRAISNPVGPRKRGEWQLEDALHTLTGLTVQLKGGM"
     atgaagcaga ttttgatcgt gacatccgtg gataaagaac ggcaggcagt ggaagccgga        60
     ctcaaaggcg atccgcgatt tctcaccggt ctctgcggcg tcggtcctgt ggaggccgca       120
     gtacggacga tgaagctgtt gtcaacgtgc tcatcctccg ttgaagccgt attgaacctc       180
     ggtgttgccg gcgggattcc cgggaaggcg gctgtcggag aagcggtact cgggacaaag       240
     accgtacagg cggatctcgg gtttgaacag gcggacggat cttttgaagc catcgaagcg       300
     cttggcttta ccgtctccga acgtgatgcc aattctgact tgatcagccg ggtaagagag       360
     gcattgcggg agaacgtaca tgagggaccg attgtcaccc agtcgacggt caccggaacg       420
     aaggcatctc tggaaacttt gttgcagcgc gttcctgatg cgatggccga aggaatggaa       480
     ggattcgccg ttcattcggc ggctgaagca tacgggattc cggcccttga gctacgggca       540
     atttccaatc ctgtcggccc ccgaaagcgc ggggaatggc aactcgagga tgcgttacat       600
     acactgaccg gtctgacggt tcaattaaag ggggggatgt aa                          642
//

If you have problems or comments...

PBIL Back to PBIL home page