(data stored in ACNUC7421 zone)

EMBL: CP001791.PE467

CP001791.PE467       Location/Qualifiers
FT   CDS_pept        complement(506537..507274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0481"
FT                   /product="peptidase C60 sortase A and B"
FT                   /note="PFAM: peptidase C60 sortase A and B; KEGG:
FT                   shn:Shewana3_2409 sortase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98019"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042001"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXG2"
FT                   /inference="protein motif:PFAM:PF04203"
FT                   /protein_id="ADH98019.1"
FT                   /translation="MRLNNKILPAFVLVLILTAAGCSQVSDNEDTLSEPSENNTVEGNS
FT                   QTGVNDVLADGESETEEPIESAGSETDSKENSQVVQTTEPVQPVSSGPRGIDPSVISIP
FT                   AIDVRADIEDVGILENGQMGVPDDGDTVGWFHRGPKPGAAGNSVMAGHVDDRSGPAIFF
FT                   DLDQLTLGDRIYIEDVEGTELAFEVTRMEVYPYDDAPMDLIFGPSATQRLNLITCTGEF
FT                   DRNAGTHRERLVVFTELVTDQEL"
     atgcgtttga acaataagat actcccggcc tttgtgctgg ttctgatcct gactgcagct        60
     ggctgcagtc aggtttcaga taatgaagac acgctgtctg aaccatcgga aaacaacact       120
     gtggagggaa acagtcagac aggtgtaaat gatgttttgg cagacggtga atcagagact       180
     gaagaaccga ttgaatctgc tggatcagag accgattcca aagaaaacag tcaggtcgtg       240
     caaacgaccg aacccgttca acccgtttca tccggtccga gagggatcga tccatcggtg       300
     atttcgattc cggccattga tgttcgtgct gacattgaag acgtggggat ccttgagaac       360
     ggtcagatgg gtgtcccgga tgacggagac actgtcggct ggttccaccg cggaccgaaa       420
     cccggcgctg ccggaaattc ggtcatggcc ggtcacgtgg atgaccgcag cggtcctgcc       480
     atcttttttg atctcgatca actaaccctg ggcgaccgga tttatataga ggatgtcgaa       540
     ggaacggaac ttgccttcga agtaacacgc atggaagtgt atccgtatga tgatgcaccg       600
     atggatctta tatttggccc ttcggccaca caacgcttaa atctgatcac ctgtaccggt       660
     gaatttgacc gaaatgccgg cacacatcgc gagcgtctcg ttgtctttac ggaacttgtc       720
     accgatcagg aactctaa                                                     738
//

If you have problems or comments...

PBIL Back to PBIL home page