(data stored in ACNUC7421 zone)

EMBL: CP001791.PE468

CP001791.PE468       Location/Qualifiers
FT   CDS_pept        complement(507258..508145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0482"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tgr:Tgr7_2678 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98020"
FT                   /db_xref="GOA:D6XXG3"
FT                   /db_xref="InterPro:IPR025510"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXG3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH98020.1"
FT                   /translation="MQLIISICCTKTNLHAKNQIEEMIQLQLKKWLLSSLAMVLMLSLF
FT                   AGTAFADNHGDDNAMVRVFHASPDAPAVDIYVNGDLAVEGAAFEDITGYLELPAGDHDV
FT                   AIHAAGEDEAVYEQTLTVEGGTHYTVAAVDFLDGGDFRLEAFVDDNTVAEGMTKVRVGH
FT                   LSPDAPAVDVGLVGGDSLFEGAEFFAVTDYLELDPDTYDLEIRAAGTEDQVLDLSGTTL
FT                   EADTVYSVYAVGALEDLGVVVVADDAYAMPGDMPQTGMGGASQSSTMLPLYLSLLAGAG
FT                   AMFVIVRRRYAFEQ"
     gtgcaactga ttattagcat ttgttgtaca aaaacgaacc ttcatgcaaa aaatcagatt        60
     gaggagatga ttcaattgca actgaaaaaa tggttactct caagtctcgc tatggtactg       120
     atgctttcat tgttcgcggg tacggctttc gctgataatc acggtgacga taacgccatg       180
     gttcgtgtgt tccacgcttc cccagatgcc ccggccgttg atatttatgt gaatggtgat       240
     ttggctgtgg aaggtgctgc atttgaagat atcacaggtt acttagaact gcctgccggt       300
     gatcacgatg ttgcgatcca tgctgccggt gaagatgaag cagtctatga gcagacactg       360
     actgttgaag gcggtacgca ttacactgtc gcagctgttg acttcctcga tggcggagac       420
     ttcagacttg aagcattcgt cgatgacaac acggtggctg aaggcatgac aaaggttcgc       480
     gttggtcact tgtctccgga tgcaccggca gttgatgtag gccttgttgg cggtgactcc       540
     ctctttgaag gagcggaatt cttcgcagtc actgactacc tcgagttgga ccctgacacg       600
     tatgatcttg aaatccgtgc tgccggcaca gaagatcagg tacttgatct ctccggtacg       660
     acacttgaag cagacacggt atattccgta tatgcagtag gcgcgcttga agacctcggt       720
     gttgttgttg tcgctgacga cgcttatgca atgcctggtg atatgccgca aaccggtatg       780
     ggcggggctt cccagtcctc cacgatgctc ccgctttacc tgagcctcct tgcgggtgcc       840
     ggtgcgatgt tcgtcatcgt ccgcagaaga tatgcgtttg aacaataa                    888
//

If you have problems or comments...

PBIL Back to PBIL home page