(data stored in ACNUC7421 zone)

EMBL: CP001791.PE471

CP001791.PE471       Location/Qualifiers
FT   CDS_pept        512740..516216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0486"
FT                   /product="methionine synthase"
FT                   /note="KEGG: glo:Glov_2133 methionine synthase; TIGRFAM:
FT                   methionine synthase; PFAM: homocysteine
FT                   S-methyltransferase; Methionine synthase B12-binding module
FT                   cap domain protein; cobalamin B12-binding domain protein;
FT                   dihydropteroate synthase DHPS; Vitamin B12 dependent
FT                   methionine synthase activation region"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98023"
FT                   /db_xref="GOA:D6XXG6"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR033706"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXG6"
FT                   /inference="protein motif:TFAM:TIGR02082"
FT                   /protein_id="ADH98023.1"
FT                   /translation="MTVTTKQASAFRDALKERILVLDGAMGTMLQNANLTPEQFGGEAY
FT                   EGCNEYLNITAPEVIRTIYHDYLEAGADIIETNTFGATDLVLDDYDLGHLAYELNKAAA
FT                   SIAVEEARAFSTDSEPRFVAGAMGPTTKSLSVTGGTTFEELSSAYKEQVEGLLDGGVDL
FT                   LLLETSQDMRNVKAAYTAIEEVLSERDLDVPLIISGTIEPMGTTLAGQTIESFYISLEH
FT                   MKPTVVGLNCATGPEFMQDHLRSLSELSTGFVHCYPNAGLPDEEGHYHETPSSLASKLR
FT                   DFAEKGWLNVVGGCCGTTPEHIRAMKEAVRGFAPRQPAQETHHSISGIEPLIYDESLRP
FT                   ILVGERTNVIGSKKFKRLIADGKFEEASEIARAQVKRGAMVVDVCLADPDRDEMADMEQ
FT                   FLHYVINKVKVPLMIDSTDEHVIEKALTYSQGKAIINSINLEDGEERFEAVCPLIRRYG
FT                   AAVVVGTIDEEGMGVSAERKLAIAKRSYELLTGKYGIAPEDIIFDPLVFPVGTGDEQYI
FT                   GSAEATVEGIRLIKKAFPRTMTILGVSNVSFGLPPLGREVLNAAFVYHCTKAGLDYAIV
FT                   NTEKLERYGSVSEDEKKLADELLFRTSDETLAEFTAFYRAKKPQQKVEASKRTLEERLA
FT                   NYIIEGTKEGLYTDLDEALAKYPDPLDIINGPLMDGMDEVGKLFNNNELIVAEVLQSAE
FT                   AMKAAVAHLEPHMEKKESDDRGKGKILLATVKGDVHDIGKNLVEIILSNNGFQVVNLGI
FT                   KVASHELIEAVEREDPDYIGLSGLLVKSTQQMVITANDLRERGIDIPILVGGAALTRKF
FT                   TETKITRQYNGLVLYAKDAMNGLSLANKLAKPETRDELVAVQHEKQLKLNEAEAAGDGM
FT                   ASKGKTNTATADPAQSEVSRDHKVYQPEDFEPHILRDFRLTHLQPYLNLQTLLGSHLGV
FT                   NGNVRRKLESGDERTKELLDKVNALIQKGEQEKLLRADGMYQFFPAQSNGNDILIYDPN
FT                   DESSVIERFTFPRQTQAPYMCLSDFLKSVDSGEMDRVGFLAVTAGKGIRKLAEAAKESG
FT                   DYLDSYLVQAVALELAEGFAERVHQQMRDKWGFSDPVDLTMQDRFSARYQGVRVSYGYP
FT                   ACPNLEDQKKLFGLLKPEKIGIELTDEYMMEPEASVTAMVFSHPEGRYFNV"
     atgacagtca caacgaaaca ggcatcggca ttccgtgatg ccctgaaaga gcggatactc        60
     gttcttgacg gtgccatggg cacgatgctt caaaatgcca atcttacccc tgaacagttt       120
     ggcggggagg catatgaagg atgtaatgaa tacctgaaca tcaccgcacc ggaggtcatc       180
     cgcaccattt atcacgatta tcttgaagca ggggcggata tcattgagac gaatacattc       240
     ggtgcgacgg atctcgtcct tgatgattat gatctcggcc atttggcgta tgagctgaat       300
     aaagcggccg cttcgatcgc cgtcgaagag gcccgggctt tttcgacgga ctcggagccg       360
     cggtttgtcg ccggtgcgat gggaccgacg acgaagtccc tgtccgtcac gggcgggacg       420
     acttttgaag aactgtcttc cgcttacaaa gaacaggttg agggccttct tgacggaggt       480
     gtggatctcc ttctccttga gacgagtcag gatatgcgga atgtgaaagc cgcctatacg       540
     gcaattgaag aggtcctgtc agagcgtgat ctcgacgtgc ctttgatcat ttccggtacc       600
     attgaaccga tgggcacgac ccttgccggt cagacgatcg agtccttcta tatttccctt       660
     gaacatatga aaccgactgt cgtggggctg aactgtgcga cggggccgga gtttatgcag       720
     gatcacctcc ggagtctgtc cgagctctcc acgggctttg tccactgtta cccgaacgcc       780
     gggctgcctg atgaggaagg gcattaccat gagacaccat cttccctggc ttcaaagctg       840
     agggactttg ccgagaaggg ctggctgaat gtcgtcggcg gctgctgcgg cacgacgccg       900
     gaacatatcc gcgccatgaa agaagccgtg cggggctttg cgccaaggca gccggcacaa       960
     gagacccacc acagcatttc cgggattgaa ccgctgattt atgatgagtc gcttagaccg      1020
     atcctcgtcg gagagcggac gaacgtcatc ggcagtaaga aattcaaacg gctgatcgcg      1080
     gacggtaaat tcgaagaggc ttcggaaatc gcccgggcac aggtgaaacg gggggcgatg      1140
     gttgtcgacg tctgcctggc ggatccggac cgcgatgaga tggcggatat ggaacagttt      1200
     ctgcactatg tcatcaacaa agtcaaagtc ccgctgatga tcgattccac tgacgagcat      1260
     gtcattgaga aagccctgac gtactcacag gggaaggcga tcatcaactc catcaatctt      1320
     gaagacggcg aagaacgttt cgaagcggtc tgtccgctga tccggcgtta cggcgccgcg      1380
     gtggtcgtcg ggacgattga tgaagagggc atgggtgtct ctgctgaacg aaagcttgcg      1440
     atcgccaagc gctcctatga actcctgacg gggaaatacg gcatcgcgcc ggaggatatc      1500
     atctttgatc ccctcgtatt ccccgtcgga accggtgatg aacagtatat cggttctgca      1560
     gaagccaccg tggaggggat ccgtctcatt aagaaagcct tcccgcggac gatgacgatt      1620
     ctcggagtca gtaacgtctc cttcggtctc ccgcccctcg ggcgtgaagt gctgaatgcg      1680
     gcttttgttt atcactgtac gaaagcggga ctcgactatg ccattgtgaa taccgagaag      1740
     ctcgagcggt acggatcggt gtcggaggat gaaaaaaagc tcgccgatga gctcctcttc      1800
     agaacgtctg acgagacgct tgccgagttc acggcctttt accgggcgaa aaaaccccag      1860
     cagaaggtcg aagcatccaa gcgtaccctt gaagagcgcc ttgcaaacta tatcattgaa      1920
     ggaacgaaag aaggtttgta cacggatctt gacgaggccc ttgcaaagta cccggatccc      1980
     cttgacatca ttaacggtcc tttgatggac ggcatggatg aagtgggtaa gctcttcaat      2040
     aacaacgagc tgatcgtcgc agaagtgctt cagtctgccg aagcgatgaa agcggcggtg      2100
     gcgcatctcg agccgcatat ggagaaaaaa gaatccgatg accgtggaaa agggaagatt      2160
     ctccttgcca ccgtcaaagg ggatgtccat gacatcggga agaacctcgt ggagatcatt      2220
     ctctcgaaca acggctttca ggtcgtgaac ctcgggatca aagtggcatc acatgaactg      2280
     attgaagcgg tggaacgcga ggatccggac tatatcggct taagcgggct gctcgtcaag      2340
     tcgacccagc agatggtcat caccgccaat gacttgagag agcggggcat tgatatcccg      2400
     atcctcgtcg gcggagctgc cttgacccgg aaattcacgg aaacaaaaat cacccgccag      2460
     tacaatgggc ttgtccttta tgcgaaagac gccatgaacg ggctctccct cgcaaacaag      2520
     ctcgccaaac cggaaacccg ggatgaactc gtcgccgttc agcacgaaaa gcagctgaag      2580
     ctgaacgaag ccgaagcggc aggtgacggg atggctagca agggcaaaac caatacggca      2640
     acggcggatc cggcacagtc agaagtgagc agggatcata aagtctatca gccggaggac      2700
     tttgagccgc acattctccg tgatttccga ctgacccatc tccagccgta tctgaatctc      2760
     cagacccttc ttggcagtca tctcggtgtg aacgggaacg tcaggcgaaa gcttgaaagc      2820
     ggggatgaac ggacgaaaga gcttctcgat aaagtgaacg ccctcataca aaaaggggaa      2880
     caggagaaac tccttcgggc tgacgggatg tatcagttct tccctgccca gtcgaatggg      2940
     aacgatattc tgatctatga cccgaacgat gagtcatcgg tcattgaacg tttcactttc      3000
     ccgagacaaa cacaggcgcc ttatatgtgt ctgtccgact ttttgaaaag tgtggacagc      3060
     ggggagatgg accgggtcgg cttcctcgcc gtcaccgcag ggaaaggcat ccgcaagctt      3120
     gctgaggcgg cgaaggaaag cggggattac ctcgacagct acctcgtaca ggcggtggcc      3180
     cttgaacttg cggaaggttt cgccgagcgg gttcatcagc agatgcggga taaatgggga      3240
     ttctccgatc ctgtggatct caccatgcag gaccgctttt ccgcaaggta tcagggagtc      3300
     agggtgtcct acggctaccc ggcctgtccg aatcttgaag atcagaagaa gctgttcggg      3360
     ctgttaaagc cggagaagat cggcattgaa ttgacggatg aatacatgat ggagccggaa      3420
     gcaagtgtga cggcgatggt cttctcacac ccggaagggc gttatttcaa cgtctga         3477
//

If you have problems or comments...

PBIL Back to PBIL home page