(data stored in ACNUC7421 zone)

EMBL: CP001791.PE472

CP001791.PE472       Location/Qualifiers
FT   CDS_pept        516341..517273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0487"
FT                   /product="Inorganic diphosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="KEGG: sun:SUN_1298 putative manganese-dependent
FT                   inorganic pyrophosphatase; PFAM: DHHA2 domain protein;
FT                   phosphoesterase RecJ domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98024"
FT                   /db_xref="GOA:D6XXG7"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR004097"
FT                   /db_xref="InterPro:IPR022934"
FT                   /db_xref="InterPro:IPR038222"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXG7"
FT                   /inference="protein motif:PRIAM:3.6.1.1"
FT                   /protein_id="ADH98024.1"
FT                   /translation="MSEEKVLIFGHRNPDTDTICSALVYADLKTKLGENVEAVRLGEVG
FT                   AETQCALDTFGVTAPRMMEHVSDEASKVILVDHNERQQSAEDIDQVQVTEVIDHHRIAN
FT                   FETDSPLYYRAEPVGCTATILNKMYKEHGVEVSKEMAGLMVSAIISDSLLFKSPTCTDE
FT                   DLAAAKELAPVAGIDLDEYGLEMLKAGANMAEKTPEQLITLDSKEFAMGDVKAVIGQVN
FT                   VVDAGDVLDRQAAVEEAMQKEVESRGLGLYMLAVTDILNSNSIALAVGDKKEAIEQAFD
FT                   VRFENGQATLEGVVSRKKQIVPPLQKLLG"
     atgagcgaag aaaaagtatt gattttcggt caccggaatc cggataccga cacgatctgt        60
     tcggctctgg tgtatgcgga tttgaaaacg aagcttggtg agaacgtgga agccgtccgc       120
     ctcggtgaag tgggtgcgga gacgcagtgt gccctcgata cattcggtgt cacggcgcca       180
     aggatgatgg agcacgtcag tgacgaagct tcaaaggtga ttcttgtgga tcataatgag       240
     cgtcagcaga gtgcggaaga tatcgatcag gtacaggtca cggaagtcat cgaccatcac       300
     cggattgcga actttgagac ggacagcccg ctgtattacc gggcggagcc ggttggatgc       360
     acggcgacga tcctgaacaa gatgtacaaa gaacatggtg tcgaggtgtc caaagagatg       420
     gcgggcctga tggtctccgc gatcatctca gactcccttc tctttaaatc accgacatgc       480
     acggatgaag acttggcagc ggcgaaagag cttgcaccag tcgccggtat cgatcttgac       540
     gaatacggtc ttgagatgct gaaggccgga gcgaacatgg cggagaaaac gccggagcag       600
     ctaattacgc ttgactcgaa ggagttcgcc atgggggatg tgaaagcggt catcggtcag       660
     gtgaacgtcg tggatgcagg agatgtcctc gatcgccagg cagcggttga agaagcgatg       720
     caaaaagaag tggagagccg cggtctcggg ctctatatgc tcgcggtgac ggacatcctc       780
     aacagcaact ccattgccct tgctgtaggt gataagaaag aagctattga acaggccttt       840
     gatgtgcgct ttgaaaacgg acaggcgacg cttgaaggcg tggtatcacg gaagaaacag       900
     attgtcccgc cattgcagaa actgctcggt taa                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page