(data stored in ACNUC7421 zone)

EMBL: CP001791.PE474

CP001791.PE474       Location/Qualifiers
FT   CDS_pept        complement(518948..519631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0490"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="KEGG: ent:Ent638_2505 polar amino acid ABC
FT                   transporter, inner membrane subunit; TIGRFAM: polar amino
FT                   acid ABC transporter, inner membrane subunit; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98026"
FT                   /db_xref="GOA:D6XXG9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXG9"
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /protein_id="ADH98026.1"
FT                   /translation="MSQIEWQYIFDPALAWRALPTVLEGLTLTLYISLISMVLGLVMSL
FT                   FLALARQSGHLYLQIPARMYISFMRGVPILIILFMLYFGFPYIGIEFTAVNAAIIGFSF
FT                   NSAAYMAEINRSAIDAVPKGQWEAARSLGLSYTKMMRQVVLPQASRIAVPPLTNVLLDL
FT                   IKASSLAAMITVPEIFQMSRIVAGREMDYMTMFILVAMIYWVICTLMTQLQNYLEKRFA
FT                   RYGEL"
     atgagccaga ttgaatggca gtatatcttc gatcccgccc tcgcctggcg ggctttgccc        60
     acagtcctcg aaggactgac gctgacgctc tatatttcgc tgatcagcat ggtgctcggt       120
     cttgtgatga gtctctttct cgcactggca agacagtccg gacacctcta tctgcaaatt       180
     cctgcacgga tgtacatttc cttcatgcgg ggtgtgccga ttctgatcat tttgttcatg       240
     ctctattttg gctttcctta tatcgggatt gagttcacgg cagtgaatgc cgccattatc       300
     ggcttcagct ttaacagtgc agcctatatg gcggaaatca accgctcagc gattgacgcc       360
     gtaccgaagg gacaatggga agccgcacga tcccttggac tgagctacac gaagatgatg       420
     cggcaggtcg tccttcctca ggcatcgcgg atcgccgttc ccccgctcac gaacgtgctg       480
     cttgatctca ttaaagcctc atcccttgcc gcgatgatca ccgtccctga gatctttcag       540
     atgtcgagga tcgttgccgg ccgggagatg gattacatga caatgttcat tctcgttgcc       600
     atgatttact gggtgatctg tacgctgatg acccagctgc agaactatct ggagaaacgc       660
     tttgcccgct atggcgagct ttaa                                              684
//

If you have problems or comments...

PBIL Back to PBIL home page