(data stored in ACNUC7421 zone)

EMBL: CP001791.PE475

CP001791.PE475       Location/Qualifiers
FT   CDS_pept        complement(519719..520591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0491"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="KEGG: ccv:CCV52592_2239 flagellar hook protein FlgE;
FT                   PFAM: extracellular solute-binding protein family 3; SMART:
FT                   extracellular solute-binding protein family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98027"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXH0"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ADH98027.1"
FT                   /translation="MENETMPFFKTAAAVLTTGLLLTACGNGDGNETASDNDTGGEPSS
FT                   WDEIEESGVLTVATSGTLYPTSFHDEDEGLTGFEVEVTREAAERLGLEVEFTEMGFDGM
FT                   LTSINSGQVDLAVNDIDINEDREERFLFTDPYKFSYGAMIVRPDDFSGIETLEDLEGKK
FT                   HGGAATTIYMQIAESYGAEGVTYENVTNDTYLRDIENGRLDVVMNDFYLQSLAIEALPE
FT                   IDVVIHPDLFYHPNNQAMIMKEDSHELQEQLNRVIAEMMEDGTITALSEQFFGGQDVSQ
FT                   EPDVDFDDE"
     atggaaaacg aaacaatgcc ttttttcaaa acagcagcag cggtcctcac aaccggtctg        60
     ttgcttacag cctgcgggaa cggagacggc aatgagaccg cttctgacaa cgatacaggc       120
     ggcgaaccaa gcagctggga tgagatcgag gagagcgggg ttctcactgt ggccacttcc       180
     gggacactct acccgacatc cttccacgat gaagatgagg gcctcacggg ctttgaagtg       240
     gaagtcacac gggaagccgc tgaacgcctt ggccttgagg tggaattcac cgaaatgggc       300
     tttgacggga tgctcacctc catcaacagc ggtcaggtgg atctcgccgt caatgatatc       360
     gacatcaacg aggatcgtga agagcgcttt ctgttcacgg atccctataa attctcctac       420
     ggtgcgatga tcgtccgtcc tgatgatttc tccggcatcg aaacgctcga agaccttgaa       480
     gggaaaaagc acggcggcgc agcaacaacc atctacatgc aaatcgctga aagctatggc       540
     gcagaaggcg tcacttatga gaatgtcacc aatgacacgt acttaagaga cattgagaac       600
     ggccgtctcg acgtcgtcat gaatgacttt tacctgcagt ccctggccat tgaggctctg       660
     cctgaaatcg atgtggtcat tcaccctgac ctcttctatc acccgaacaa tcaggccatg       720
     atcatgaaag aagacagcca cgagctccag gaacagctga accgcgttat cgcagagatg       780
     atggaagacg gcacgattac cgccctgtcc gaacagttct ttggcggtca ggacgtctcc       840
     caggagccgg atgtcgattt cgacgacgag taa                                    873
//

If you have problems or comments...

PBIL Back to PBIL home page