(data stored in ACNUC7421 zone)

EMBL: CP001791.PE478

CP001791.PE478       Location/Qualifiers
FT   CDS_pept        complement(524610..525974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0494"
FT                   /product="magnesium transporter"
FT                   /note="TIGRFAM: magnesium transporter; PFAM: MgtE integral
FT                   membrane region; CBS domain containing protein; MgtE
FT                   intracellular region; KEGG: pca:Pcar_0596 magnesium
FT                   transporter; SMART: CBS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98030"
FT                   /db_xref="GOA:D6XXH3"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXH3"
FT                   /inference="protein motif:TFAM:TIGR00400"
FT                   /protein_id="ADH98030.1"
FT                   /translation="MSFNRSDIQTIYENELKAMIQDRDKAGFKEVVTSLHPQDQMDLYV
FT                   HLREQERRFLYETMPPQAFALVFQELDVLDQTRYIHELEEDYARAVIRHMASDEAADFL
FT                   LQTRQDKVSRLLEESDDAFSRNIKELLTYEEETAGSIMTKEFISLRTTDRISDVIAMLR
FT                   VEGPKAETIYYLYVIDDRHKLVGVASLRDLIVAEPDAFVQDVMSTRLISVKALDDQEDV
FT                   AHLFKKYDFLAIPVVTEKRKLIGIITVDDILDVMEAEQTEDLGEFAASRGATDVSLSPV
FT                   TAAKKRAPWIILLMFFGMITAGVIGQFEETLEAIVLLAGFIPLIMDSAGNTGTQSLAVA
FT                   VRSLALGTVEKKGVRNMIAREFRTGVMLGLMCAVTLIVIVPVIYPGEFLLAGIVAVSIL
FT                   FSLSLATVIGTVVPLIIHKLNLDPAIASGPFITTVNDIIGLMIYFTFATSLLQYL"
     ttgtctttta acagaagcga cattcaaacc atctatgaga acgaactgaa ggccatgata        60
     caggaccgtg acaaagcggg atttaaagag gtggttacct cccttcatcc tcaggatcag       120
     atggatctgt atgtacatct tcgcgaacag gaacgtcgtt tcctttatga aaccatgccg       180
     ccgcaagcgt tcgctctcgt ctttcaggag cttgatgtcc ttgatcagac ccgctatatt       240
     catgagctcg aggaagacta tgcacgggct gtgatccggc acatggcctc ggatgaagca       300
     gcggattttc ttctgcagac aaggcaggac aaagtatcgc gactcctcga agagtccgat       360
     gatgcttttt cgagaaacat taaggaactc ctgacgtacg aagaagaaac tgcggggtcg       420
     atcatgacca aagagttcat cagtctgagg acgacggacc ggatttcgga tgtcattgcc       480
     atgcttcgcg ttgaagggcc gaaagccgaa acaatctact atctctatgt cattgatgac       540
     cgacataagc ttgtgggcgt cgcctccctt agggatctga tcgttgccga acccgacgcc       600
     ttcgttcagg atgtgatgag tacaaggctt atttctgtaa aggctctcga cgatcaggag       660
     gacgtggccc atctgtttaa gaaatatgac ttcctcgcga tccctgttgt cacggaaaaa       720
     cgcaaactga tcggtatcat taccgtcgat gatattctcg acgtcatgga agccgaacag       780
     acggaagatc tcggtgagtt cgccgcttcc aggggagcta ccgacgtctc gctgtcccct       840
     gtgactgccg ccaaaaaacg cgcaccgtgg atcattcttc tcatgttttt tgggatgatc       900
     acggctggcg ttatcgggca gttcgaggag acccttgaag cgatcgtcct ccttgccgga       960
     ttcattccac taattatgga ctccgccggt aacaccggca cacagtctct tgccgtcgcc      1020
     gtccgctcac tcgcccttgg caccgtcgag aaaaaaggcg tcaggaacat gattgcccgg      1080
     gaattcagaa cgggcgtcat gctcggactg atgtgtgccg tgacgctgat tgtgattgtg      1140
     ccggtcatct atcctggcga gtttcttctg gctggcatcg ttgccgtttc cattctgttc      1200
     tcgctcagtc tcgcaaccgt aatcgggacg gtcgtgcccc tgatcattca caagctcaat      1260
     ctcgatccgg ccatagcatc cggtcctttc ataaccactg tgaacgacat tatcggtctg      1320
     atgatttatt tcacgttcgc cacctccctg cttcagtatt tatga                      1365
//

If you have problems or comments...

PBIL Back to PBIL home page