(data stored in ACNUC7421 zone)

EMBL: CP001791.PE48

CP001791.PE48        Location/Qualifiers
FT   CDS_pept        58187..59053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0049"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /note="KEGG: gme:Gmet_2849
FT                   4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; TIGRFAM:
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol kinase; PFAM:
FT                   GHMP kinase; GHMP kinase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97600"
FT                   /db_xref="GOA:D6XV42"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV42"
FT                   /inference="protein motif:TFAM:TIGR00154"
FT                   /protein_id="ADH97600.1"
FT                   /translation="MYLTEKAPAKINLTLDVLRKRKDGYHDVEMIMTTVDLADRIHLHP
FT                   LEKDEIVIEVENGILPLDKNNLAYQAASLLKKRCKVTTGVKIVIDKIIPVSAGLAGGST
FT                   DAAAVLRGLNKLWRLGLSLDDLAEIGLRIGSDVPFCVYGGTAIARGRGEDLTFIDAPPK
FT                   VWVLLAKPPQGVSTKEIYKRLKPGEMAHPDTAGMVEAIRTKDYRGICERLENVMEPVTF
FT                   SLAPDVARIKKRLESSGADGTVMSGSGPTVFSLIANDQKAHRLYNTLRGFMDQVYLVRL
FT                   IGERHQI"
     gtgtatttaa ccgaaaaagc cccggctaaa attaatctga cattggatgt tctgagaaaa        60
     cgcaaggacg ggtaccatga tgtggaaatg attatgacga ccgtggatct ggctgaccgg       120
     attcacctgc atcccctcga aaaggatgag atcgtgattg aggtggagaa cgggattctg       180
     ccgctggata agaacaatct tgcttatcag gcagcaagcc ttttgaaaaa acgctgcaag       240
     gtcacgacgg gtgtgaaaat cgtgatcgat aagattatcc ctgtctcggc gggactcgcc       300
     ggaggcagca ccgatgcagc ggctgtcctt cgaggtttga ataagctctg gaggctcggt       360
     ttgagtcttg atgatctggc tgaaatcggc cttcggatcg gctcggatgt tccgttttgt       420
     gtctatggcg gtacagccat agcccggggc aggggagaag acctgacctt tatcgatgca       480
     ccgccgaagg tctgggtgct ccttgccaag cccccgcagg gtgtttcgac aaaagagatt       540
     tacaagcggc tgaaaccggg tgagatggcc catcctgata cggcaggcat ggtcgaagca       600
     atccggacga aggattaccg gggcatctgt gaacgtctgg agaacgtcat ggagccggtg       660
     acctttagtc tcgcaccgga cgtggcaagg atcaaaaaga ggctcgagag ttccggtgca       720
     gacgggacgg tgatgagcgg cagcgggccg acggtgttct cgctgattgc gaatgatcaa       780
     aaggcgcaca ggctgtataa tacgcttcgc ggatttatgg atcaggtcta tctcgtccgg       840
     ctgatcggag aacggcatca gatatag                                           867
//

If you have problems or comments...

PBIL Back to PBIL home page