(data stored in ACNUC7421 zone)

EMBL: CP001791.PE480

CP001791.PE480       Location/Qualifiers
FT   CDS_pept        528014..528784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0496"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: Sulfate
FT                   transporter/antisigma-factor antagonist STAS; KEGG:
FT                   rlt:Rleg2_5263 signal transduction histidine kinase; SMART:
FT                   PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98032"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXH5"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADH98032.1"
FT                   /translation="MTNLQELKNKVLEKTQLVFIISDPDLPDNPIIYANRGFMELTGYS
FT                   TDEVIGYNCRFLQGDDTSPQTVSILREAIRLMEPVSVEILNYKKSGEPFWNLLHIDPIY
FT                   LEEEDKYYFVGIQKDITEIKQAEQKIASYHKEIERLSTPIVPIKEGISVLPLIGSIDEE
FT                   RLNAIIERTLPALEADEVEILILDLSGFSQLDQEATVGIFQLNDLMKLKGVELILTGIT
FT                   PKIAMRTRGLGMDLSGLKTFASVKQAIEQIEKRM"
     atgacaaact tacaggaact gaaaaataaa gtgttggaaa aaacacagct cgtttttatc        60
     atcagtgatc cggatcttcc ggataatccg attatctatg cgaatcgcgg attcatggaa       120
     ttaaccggtt acagtacaga tgaagtcatc ggctataact gccgtttttt acagggagac       180
     gatacttctc cgcagacagt ttcgattctt cgtgaagcga tccggcttat ggaaccggta       240
     tcggttgaga tactgaacta taagaaaagc ggggaaccgt tctggaatct tctgcacatt       300
     gatccgattt atcttgaaga ggaagataaa tattactttg tggggattca aaaagacatt       360
     acggagatca agcaggctga acagaagatt gcaagttatc ataaggaaat tgaacgtctg       420
     tcgacgccga ttgttccgat caaagagggg atctccgtac taccgctgat cggcagtatc       480
     gatgaggaga gactgaatgc cattatcgaa cggacactgc ctgcactcga agccgatgaa       540
     gtggagattc tgattctgga tctgtccggc ttctcgcagc ttgatcagga agcgacagtg       600
     gggatctttc agctgaatga tctgatgaaa ctcaaaggtg tggaacttat tctgacgggt       660
     attacaccga agattgccat gcgcacaaga ggtcttggga tggacctgtc gggactgaag       720
     acctttgcct ctgtcaaaca ggcgattgaa cagattgaaa aacggatgtg a                771
//

If you have problems or comments...

PBIL Back to PBIL home page