(data stored in ACNUC7421 zone)

EMBL: CP001791.PE484

CP001791.PE484       Location/Qualifiers
FT   CDS_pept        complement(531511..531936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0500"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: dvm:DvMF_1529 UspA
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98036"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXH9"
FT                   /inference="protein motif:PFAM:PF00582"
FT                   /protein_id="ADH98036.1"
FT                   /translation="MFSNIILAADGSEHSLRAAEKAIALGKLSKKPQIELLHVVSGATS
FT                   KTDVLHHGDSDAASRKRRKQLDPIVERIERANIPVTVTTITASNSVPESIIKHVNEQNP
FT                   DVLVLGSRGLSSVQTMVLGSVSHKVMKYVKAPVMMVK"
     atgttttcaa acattattct ggccgcagac ggatctgaac actccctgcg cgcagcagag        60
     aaagccattg cactcggcaa actgtccaaa aaaccgcaaa tcgaactgct tcacgtcgtt       120
     tccggcgcta cgtctaaaac cgatgtcttg catcacggcg attccgatgc tgccagccga       180
     aaacgccgca aacagcttga tccgatcgtg gaacgtattg aacgagccaa cattccggtc       240
     accgttacga ccattaccgc aagcaacagc gtcccggaat ccattattaa acatgtcaat       300
     gagcaaaatc ccgatgtcct tgttctcgga agccgcggtc tcagttcggt ccagacgatg       360
     gttctcggaa gcgtcagcca caaagtcatg aaatatgtca aagcgcctgt gatgatggtc       420
     aaataa                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page