(data stored in ACNUC7421 zone)

EMBL: CP001791.PE486

CP001791.PE486       Location/Qualifiers
FT   CDS_pept        533747..534163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0502"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98038"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXI1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH98038.1"
FT                   /translation="MRILMIVLLFVITACAPPTNQEGITLEIDATYTSGTLYLVPMIVH
FT                   EGNEAVSVSLYDAELRIVEVTREDATVYDSSPGSTGDEPVILEQGEVYEGSPVRFTAEA
FT                   GEYEVRAVAEITVTDDELAEDLSLSTEVTVQVQG"
     gtgagaatac tgatgatcgt tctgctgttt gtgataacgg catgtgcacc accaacaaat        60
     caggaaggaa ttacgcttga aatagatgct acgtatacga gcggcaccct ttacctggtc       120
     ccgatgattg tgcacgaagg gaatgaagca gtatcagtgt cactctatga tgcggaactg       180
     cgcatagtgg aagtgacgag ggaagatgcg acggtttacg attcctcgcc gggaagcacc       240
     ggggatgagc ctgtcatcct cgaacaggga gaggtctatg aggggtcgcc ggtccgcttc       300
     accgcagagg caggggaata tgaagtacgg gcagttgccg agatcaccgt gactgatgat       360
     gaacttgcag aggacttgtc tctctcaaca gaagtgacgg ttcaggtgca aggctga          417
//

If you have problems or comments...

PBIL Back to PBIL home page