(data stored in ACNUC7421 zone)

EMBL: CP001791.PE488

CP001791.PE488       Location/Qualifiers
FT   CDS_pept        534716..535711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0504"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="KEGG: rso:RSp1286 putative DNA-binding sucrose
FT                   operon transcriptional repressor transcription regulator
FT                   protein; PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; SMART: regulatory
FT                   protein LacI"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98040"
FT                   /db_xref="GOA:D6XXI3"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXI3"
FT                   /inference="protein motif:PFAM:PF00356"
FT                   /protein_id="ADH98040.1"
FT                   /translation="MVTINDIARQAGVSRTTVSRVLNQNGYVSDRAKTKVLEVIEETGY
FT                   VPSEQAKSLRTKKTNVIGVILPRLSSETVSRVVDGMDRELAKAGYQILLSSTSLETEKE
FT                   ADHIRLLESRRVDGIVLFGTHKDEAILNAIKQAKVPVVVLGQDFTPHVSSVVYNDYEAS
FT                   RAAVAALADVGHEKIGFIGVDEADIAVGQERRRGYLDEMKSRGFAVLPEWMQTAGFDMA
FT                   SGSEAFQKMLEYSQTRPTAVFAVTDRLAIGAMQRAKDAGMSVPGEMAFISIGASEASQV
FT                   VTPKLATVDYYNEDAGMSIASLILEEIDEDMKDAKKIVMNYGLLLRDSLC"
     atggtaacca tcaacgatat tgccagacag gcgggtgtat ccagaacaac cgtttcaaga        60
     gtattgaatc aaaacggcta cgtcagtgac cgtgcaaaaa cgaaagtcct cgaggtcatt       120
     gaagagaccg gctatgtccc gagtgaacag gcaaaatcac tcaggacgaa gaagacaaat       180
     gtcatcggcg ttatactgcc gaggctcagt tcggaaaccg tgagccgggt tgtggacggc       240
     atggaccgtg aacttgcgaa ggcaggttat cagattttgc tttcgagtac gagtcttgag       300
     acggagaagg aagctgatca tatccgtctt ctcgagagca ggagggtgga cgggatcgtt       360
     ttgtttggca cacataaaga tgaagcaata ctgaatgcca tcaagcaggc gaaagtgccg       420
     gtcgtggtgc tcggccagga ttttacacct catgtgtcat cggttgtgta caacgattac       480
     gaggcatcaa gagcagccgt ggcggctttg gcagatgtcg gacatgaaaa aatcggtttc       540
     atcggagtcg atgaagcgga tatcgctgtc ggtcaggaga gacgccgggg ctatcttgat       600
     gaaatgaaaa gccgtggatt cgcggtttta ccggagtgga tgcagacagc aggttttgat       660
     atggcgtcag gcagcgaagc ctttcagaag atgcttgagt acagtcagac aaggccgacg       720
     gcggtctttg ccgttaccga ccgtcttgca atcggagcga tgcagcgtgc gaaagatgcc       780
     ggcatgtccg tacccggaga aatggctttt atcagtatcg gtgcatctga agcttcgcag       840
     gtcgtcaccc caaaattggc tacggttgat tattataatg aggatgcggg tatgagtata       900
     gcaagcctga tccttgaaga aatcgatgaa gacatgaaag atgcaaaaaa aatcgtgatg       960
     aactatggac ttttgcttcg cgatagttta tgctga                                 996
//

If you have problems or comments...

PBIL Back to PBIL home page