(data stored in ACNUC7421 zone)

EMBL: CP001791.PE490

CP001791.PE490       Location/Qualifiers
FT   CDS_pept        537350..537757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0506"
FT                   /product="Camphor resistance CrcB protein"
FT                   /note="PFAM: Camphor resistance CrcB protein; KEGG:
FT                   pmy:Pmen_2385 camphor resistance protein CrcB"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98042"
FT                   /db_xref="GOA:D6XXI5"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXI5"
FT                   /inference="protein motif:PFAM:PF02537"
FT                   /protein_id="ADH98042.1"
FT                   /translation="MEKQMFYITIAVFVGGAAGTLLRFFINEWSSMALFPLGTVIENIS
FT                   GSLLLGLLTGWAAYRYMNPFFKEGLGAGFCGGFTTMSTLMADVTLLATAGGEAVLMTGL
FT                   YVFVSLAGGLIAAFTGIVLGERFAGKEGDGA"
     atggaaaaac agatgttcta tattacgatc gccgtcttcg taggcggtgc agcgggtacc        60
     ctgctcaggt ttttcatcaa tgaatggtcg tcgatggcgc tgtttccttt agggaccgtc       120
     atcgagaata tatccggcag tcttcttctc ggacttttga ccggatgggc agcgtaccgg       180
     tatatgaatc cgttttttaa agaaggactc ggcgccggat tttgcggggg gtttacgacg       240
     atgtccacgc tgatggcgga tgtgacgctc cttgcgacgg ccgggggaga agcggttctc       300
     atgacaggcc tgtatgtatt cgtttccctt gcaggtggat tgatcgccgc ctttacaggg       360
     attgtgctcg gggaacgatt cgcgggaaag gaaggtgatg gtgcatga                    408
//

If you have problems or comments...

PBIL Back to PBIL home page