(data stored in ACNUC7421 zone)

EMBL: CP001791.PE491

CP001791.PE491       Location/Qualifiers
FT   CDS_pept        537775..538140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0507"
FT                   /product="CrcB protein"
FT                   /note="KEGG: ftm:FTM_1582 CrcB family protein; TIGRFAM:
FT                   CrcB protein; PFAM: Camphor resistance CrcB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98043"
FT                   /db_xref="GOA:D6XXI6"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXI6"
FT                   /inference="protein motif:TFAM:TIGR00494"
FT                   /protein_id="ADH98043.1"
FT                   /translation="MASLGGGLGAVARYHLGRLIKARLDQTWLPNAMLIVNIIGSFGLG
FT                   VTLGGLFGSVTETDPLPNLYFFLATGFMAAFTTFSTFSTEAVGLIRTRKFYPACLYISV
FT                   TLVASFLVFLAGMWLTV"
     atggcgtcac tcggcggtgg gcttggagcg gttgcccgct atcaccttgg acgcctcatt        60
     aaagccaggc tcgatcagac ctggctgccg aatgcgatgc tgatcgtgaa tatcatcggc       120
     tctttcgggt tgggtgtgac ccttggggga ctgttcggat cggtgacaga gacggatccg       180
     ttgcccaacc tctatttttt cctcgcaaca ggctttatgg cagcctttac gacgttttca       240
     acattcagta cggaggccgt tggactgatt cgcacacgta aattttatcc tgcatgtctt       300
     tatatttcgg ttacgctcgt cgcgtcattt ctcgtattcc tggccggcat gtggctcacg       360
     gtctga                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page