(data stored in ACNUC7421 zone)

EMBL: CP001791.PE492

CP001791.PE492       Location/Qualifiers
FT   CDS_pept        complement(538195..540144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0508"
FT                   /product="choline/carnitine/betaine transporter"
FT                   /note="KEGG: rhi:NGR_c26260 putative BCCT family
FT                   transporter; TIGRFAM: choline/carnitine/betaine
FT                   transporter; PFAM: BCCT transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98044"
FT                   /db_xref="GOA:D6XXI7"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="InterPro:IPR016137"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXI7"
FT                   /inference="protein motif:TFAM:TIGR00842"
FT                   /protein_id="ADH98044.1"
FT                   /translation="MEKYSYETKNPNIVFYISAPIVLAFVLWGLFFPENLANVSSVALA
FT                   FTLDNFGWFYMLVTAFFIAFVLFLAISPFGKLKLGKPDEKPEFRFFSWLGMLFAAGIGV
FT                   GFVFWGVAEPILYYYDPHPDYIGQSDAVRAEAGLRYGVFHWALHPWAIFSLVALTLAYV
FT                   QFRKDQPALISSAFQPILGDRAYGGFGKAIDVLAVLATSTGVATTFGLSALQITGGLSY
FT                   LVDWIPNNATVNFIIIAIVTFLFIFSAATGVDKGIKILSTTNLILAGLLLFFVIIVGPT
FT                   LFIAQNFVSVLGNYMSNVVQMSFDLNPFGDGEWLGNNTIFFWAWHISWAPFMGIFIARI
FT                   SRGRTIREFVAGVLIVPSLLGALWFTTFGGTGLSLIMGGNDEIGDLVMNEVELALFATL
FT                   GELPISMITSVIAVILILIFFITSADSASYVLGAMTSQGSLSPKLTIKVIWGFLIAGTA
FT                   SVLLISGGLEGLQTASIVAALPFAMIMVVMVFSLLIMMTKDMKKDKIKTQRKQTKRVKD
FT                   EVYGGMKDEFYDEFREEAYDEMKEEVYGQMKEEVYDDFKDEVYDEFKDETYDRVKDEVY
FT                   EQMKEEAYEDFKGEAYDKVKEEVYEQVKDEVYDDIKEEVYEEFKEKIYEDLRDDLGEQL
FT                   NGELESPDDEKKDK"
     atggaaaagt attcgtacga aacgaaaaat ccaaacattg tcttttacat ctcagcaccc        60
     attgttcttg cttttgttct ctggggatta ttttttccgg agaatcttgc caatgtatca       120
     agcgtggcac ttgcgttcac ccttgataac ttcggctggt tctacatgct cgtcaccgcg       180
     ttttttattg cctttgtact gtttctcgcc atcagtccct tcggtaaact gaagctcggg       240
     aagcccgatg agaaaccgga gttccgcttt ttctcctggc tcggcatgct ctttgccgca       300
     gggatcggtg tcggcttcgt attctggggt gtcgcagaac cgattctcta ttattacgat       360
     ccgcatccgg attacatagg tcaaagtgat gccgtccgcg ctgaagcagg tctcaggtac       420
     ggggtcttcc actgggcact ccacccatgg gcgatcttct cgctcgtagc actgacgctg       480
     gcatatgttc agttccgaaa agaccagccg gctctcatca gctcggcatt tcaaccgatt       540
     ctcggtgacc gtgcctatgg cggattcgga aaagccatcg acgttctcgc cgttttggcc       600
     acatccacag gggttgcgac caccttcggt ctcagtgccc tgcagattac cggcgggctg       660
     tcctacctgg ttgactggat tccaaacaat gcgaccgtca actttatcat cattgccatt       720
     gtgacgttcc tgtttatctt ttctgccgcg acaggcgtcg acaagggaat caagattctc       780
     agtaccacga atctgattct ggcagggctg cttttgttct tcgtgattat tgttggcccg       840
     acgctcttta ttgcccagaa ttttgtctcg gttctcggga attacatgtc caatgtcgtt       900
     cagatgagct ttgacttaaa cccgttcggg gacggtgaat ggcttggaaa taatacgatt       960
     ttcttctggg cctggcatat ctcctgggcg ccgtttatgg ggatcttcat cgcccggatt      1020
     tcaagggggc gtacgatccg ggaatttgtc gcaggtgttc tgattgtccc ttcactcctt      1080
     ggcgcgctct ggtttaccac gtttggcggc accgggctca gcctgattat gggcggcaat      1140
     gatgagatcg gtgaccttgt catgaacgag gtcgagcttg ctctcttcgc tactctcggt      1200
     gaactgccaa tctccatgat tacgagtgtc attgccgtga ttctgatcct gatcttcttc      1260
     atcacatcgg cggactctgc ctcgtatgta ctcggtgcga tgacgtcaca gggcagtctg      1320
     agtccaaagc ttacaatcaa agtcatctgg ggattcctca ttgccggaac cgccagtgtc      1380
     cttctcatca gcggaggact tgaagggctt cagaccgctt cgattgtcgc agcgctgccg      1440
     tttgccatga tcatggtcgt gatggtcttc agccttctga tcatgatgac aaaggatatg      1500
     aagaaagaca aaatcaagac gcagcgcaaa cagacgaaac gcgtcaaaga tgaagtctac      1560
     ggcggcatga aagatgaatt ctacgatgag ttccgtgaag aagcctatga tgaaatgaaa      1620
     gaagaagtct acggccagat gaaagaggaa gtttacgatg acttcaaaga cgaagtgtac      1680
     gatgagttta aagacgaaac ctacgaccgc gtcaaagacg aagtctatga acagatgaag      1740
     gaagaagcct atgaagactt taaaggcgaa gcttacgaca aagtgaaaga agaagtctat      1800
     gagcaggtca aagacgaagt ctacgacgat atcaaagaag aagtctatga ggagttcaag      1860
     gaaaagatct acgaagatct ccgtgatgac ctcggtgaac agttaaacgg tgagcttgaa      1920
     tcaccggacg atgagaaaaa agataaataa                                       1950
//

If you have problems or comments...

PBIL Back to PBIL home page