(data stored in ACNUC7421 zone)

EMBL: CP001791.PE495

CP001791.PE495       Location/Qualifiers
FT   CDS_pept        542035..544062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0511"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="TIGRFAM: diguanylate cyclase; PAS sensor protein;
FT                   PFAM: EAL domain protein; GGDEF domain containing protein;
FT                   PAS fold domain protein; PAS fold-4 domain protein; KEGG:
FT                   sme:SMa1548 diguanylate cyclase/phosphodiesterase; SMART:
FT                   EAL domain protein; GGDEF domain containing protein; PAS
FT                   domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98047"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXX4"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADH98047.1"
FT                   /translation="MKHIDISTALNANPDHAAIISLEGEILLTNLSWQAFSRDNTGDPD
FT                   YTDVGVNYLDVLKKAGVTAVYEGIVSVLEGRQDFYHNKYPCHSPDENRWFIMTVTPLNE
FT                   GGDIQGALIVHRNITEVEWAKNQTVDILESMTDAFFAVDQNWRFTFLNQEAEKLLQVSR
FT                   SGLIGQNIWTVFPDALGTTIQFHYETVVDMKLAKQFETYFEPLDKWFEVHAYPRHQGGL
FT                   AVFFKDISEKKASEQQIWEMANLDELTGLANRRFIYEKMNGIIQKRIPFSLFFMDLNDF
FT                   KDINDVYGHDAGDQVLQKIGERLQALQEESGGVAARLGGDEFVFMIAELDHEVTGHFAE
FT                   RLLNLIRKRMSVSGYYAFSMVGSIGIAMYPETGMNVNEIMSAADAAMYEAKKSKSVTGT
FT                   YRFYEISMREVIKRRIVMGDDMLTAIDRGDFYYVYQPQINMKTGLVDGVEVLSRWKHPQ
FT                   LGMIPPPEFIELAEETGKIRPLTERTIRDVLKTVDGWRRDWGYDGRVAFNVSSSLIESP
FT                   SFFTFIKEQMTYFKIGRDQLELEITETVNLAASEALAYHLDQFRHIGVSLAIDDFGTGF
FT                   SKISHLSRLPVDRIKVDRTFINEIGSGSKGEAILYAVIDLMNQLEVDVVAEGVEEEEQV
FT                   RVLMGRNCSHIQGYYYARPTEEEEAVSYIWSFVQTKNSER"
     atgaaacata tcgatatctc cacagccctg aatgcgaatc ccgatcacgc ggcaatcatc        60
     agccttgaag gggagattct cctgacgaat ctgtcctggc aggctttcag ccgggacaat       120
     acgggagatc cggactacac ggatgtgggt gtaaactatt tggatgttct gaaaaaagcc       180
     ggtgtgacgg ctgtgtatga gggaatcgta tcggttttgg aaggtcggca ggatttttat       240
     cataacaaat atccctgtca ttcacctgat gagaaccgct ggtttatcat gactgtcacc       300
     ccattaaatg aaggcggcga tatccagggg gctcttatcg ttcaccgaaa tatcaccgaa       360
     gtcgaatggg ctaagaatca gaccgtggac atccttgaga gcatgacgga tgcttttttc       420
     gccgtggacc aaaactggag gttcaccttt ttgaatcagg aagcggaaaa actgctgcag       480
     gtatcgaggt ccgggctgat cggtcaaaac atctggacgg ttttccctga tgcattgggt       540
     acgaccattc agtttcatta tgaaacggtt gtggatatga agctcgcaaa gcagtttgaa       600
     acgtattttg aaccgctgga taaatggttt gaagtccatg catacccccg tcatcaggga       660
     ggacttgccg tgttcttcaa agatatctcc gaaaaaaagg cgtcagaaca gcagatttgg       720
     gagatggcga atctggatga gctgactggc cttgcgaacc gccgttttat ctatgaaaag       780
     atgaacggca ttattcagaa acggatcccc ttttcactct tttttatgga cctgaatgat       840
     tttaaggata tcaacgatgt ctatggtcac gatgccgggg accaggtgct tcagaagatc       900
     ggggagcgtc tgcaagcttt gcaagaggag agcgggggtg ttgcggctag gctcggcggg       960
     gatgagtttg tgttcatgat tgcagagctt gatcatgaag taacggggca tttcgccgag      1020
     cgacttctga atctcatccg taaacggatg tctgtgtccg gctattatgc gttttcgatg      1080
     gtcggaagca ttgggatcgc gatgtatccg gaaaccggga tgaatgtgaa tgagatcatg      1140
     tcagcggcgg acgctgcgat gtatgaagcg aagaaatcaa aatcggtcac gggcacctac      1200
     cgcttttatg agatcagcat gcgggaagtc atcaagcgtc ggattgtaat gggagacgat      1260
     atgctgacgg ccattgatcg tggcgatttt tattatgtgt atcaaccgca gatcaatatg      1320
     aaaaccggac tcgtcgacgg cgtggaggtc ctctcacgct ggaagcatcc gcaactcggg      1380
     atgattccgc ctccggagtt tattgaactg gccgaagaga cgggaaagat caggccgctg      1440
     acggagcgga cgattcggga tgtgttgaag acggtggatg gctggcggcg tgattggggt      1500
     tatgatggcc gtgttgcctt taacgtgtcg agctcattga tcgagtcgcc atctttcttt      1560
     acgttcataa aagagcagat gacatatttt aaaataggaa gagatcagct tgagcttgag      1620
     attaccgaaa cggtcaacct tgccgcgtcg gaagctcttg cgtaccatct tgatcagttt      1680
     cggcatattg gtgtcagtct ggccatcgat gacttcggca ccgggttttc taaaatcagt      1740
     catttgagcc ggttgccagt ggaccggatc aaagttgacc ggacatttat caatgagatc      1800
     ggttcgggat ccaaagggga agcgattctc tacgcggtga ttgacctgat gaatcagctt      1860
     gaagtggatg tcgtggcaga gggcgttgag gaagaggaac aggttcgtgt gctgatgggc      1920
     aggaactgca gccatataca ggggtattac tacgcgagac cgactgagga ggaggaggcc      1980
     gtctcctata tctggtcttt tgtacagaca aagaacagcg aacgctag                   2028
//

If you have problems or comments...

PBIL Back to PBIL home page