(data stored in ACNUC7421 zone)

EMBL: CP001791.PE499

CP001791.PE499       Location/Qualifiers
FT   CDS_pept        545764..546300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0515"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="KEGG: pca:Pcar_3124 RNA polymerase, sigma-E factor;
FT                   TIGRFAM: RNA polymerase sigma factor, sigma-70 family;
FT                   PFAM: sigma-70 region 2 domain protein; Sigma-70 region 4
FT                   type 2; sigma-70 region 4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98051"
FT                   /db_xref="GOA:D6XXX8"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXX8"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ADH98051.1"
FT                   /translation="MREEFDRLYHQYHHQLFQYLFYLVRHRETAEELVQEVYIKVLNSF
FT                   ETFEGKSTEKTWLYSVAKHVAIDHIRKQSRKKRRAEGKEYEWSEREFEIQDKDPLPDEI
FT                   VVQKEEVQEVYQMLARCTPDQQQVMILRFVQSLSIAETAEILGWTESKVKTTQHRAIKA
FT                   LKGHLEQREEEEVHP"
     gtgagggagg aatttgacag gctgtaccat cagtatcacc atcagctctt tcaatatctg        60
     ttctacctcg tccgacaccg ggaaacggca gaagaactcg ttcaggaagt ctatatcaaa       120
     gtcctcaact cgttcgaaac cttcgaaggg aaaagcacgg aaaaaacgtg gctgtattca       180
     gtggcgaagc atgtggccat tgaccatatc cgcaagcaat cgagaaagaa acgccgcgca       240
     gaaggcaaag aatatgaatg gagcgaacgt gaattcgaga ttcaggataa agaccccctt       300
     cccgatgaaa ttgttgttca gaaagaggaa gtgcaggaag tgtatcagat gctggcaaga       360
     tgtactcccg atcagcaaca ggtgatgatt ctccggtttg tgcagtccct gtccattgcg       420
     gaaacggccg agatcctcgg ctggacggaa agcaaggtca agacgaccca gcaccgggcg       480
     atcaaagcat tgaagggcca tcttgagcag cgagaggaag aggaggtgca tccatga          537
//

If you have problems or comments...

PBIL Back to PBIL home page