(data stored in ACNUC7421 zone)

EMBL: CP001791.PE50

CP001791.PE50        Location/Qualifiers
FT   CDS_pept        60190..60501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0051"
FT                   /product="SpoVG family protein"
FT                   /note="PFAM: SpoVG family protein; KEGG: bba:Bd2801
FT                   regulatory protein SpoVG"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97602"
FT                   /db_xref="GOA:D6XV44"
FT                   /db_xref="InterPro:IPR007170"
FT                   /db_xref="InterPro:IPR036751"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV44"
FT                   /inference="protein motif:PFAM:PF04026"
FT                   /protein_id="ADH97602.1"
FT                   /translation="MNVTDVRLRRTDESGRMLAIASITIDDEFVVHDIRVIDGDNGLFV
FT                   AMPSKRTPDGDFRDIAHPICSEARMKIQSAVLDEYAKAKEQKETVYEESGTSGSAGMK"
     atgaatgtaa cagatgtcag gcttcgccga acggacgaat caggacgaat gctcgcaatc        60
     gcttccatta cgattgatga tgaatttgtc gtgcatgata ttcgcgtgat tgacggggat       120
     aacggtcttt ttgtggcgat gccgagtaag cgaacgccgg atggtgactt cagggacatt       180
     gcacatccga tctgttcgga ggcgaggatg aaaatccagt cggctgtact ggatgaatat       240
     gccaaagcca aagaacaaaa agagaccgtg tacgaagagt caggaacgtc cggatcagcg       300
     ggtatgaagt ga                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page