(data stored in ACNUC7421 zone)

EMBL: CP001791.PE501

CP001791.PE501       Location/Qualifiers
FT   CDS_pept        547689..548552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0517"
FT                   /product="SMP-30/Gluconolaconase/LRE domain protein"
FT                   /note="PFAM: SMP-30/Gluconolaconase/LRE domain protein;
FT                   KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98053"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="InterPro:IPR039096"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXY0"
FT                   /inference="protein motif:PFAM:PF08450"
FT                   /protein_id="ADH98053.1"
FT                   /translation="MLQAELVLDIKATLGEGPCWDEDSQKLIWVDIEGCTVNHFDPSTG
FT                   MNASTHVGKRVGAAVQRDQGGLILALDDGFYAFDPDSGELVHLHDPEPGVQTNRFNDGK
FT                   CDPSGRFWAGSMVLKGRKERAALYRMDPDGSLHIMETGVTISNGLEFDEARGLMYYIDS
FT                   VTKQIARYDYDGESGEIRNKTAAFSVADQPGVPDGMTIDDEGMLWVAFFNGGKVVRFAP
FT                   DSGAVLEEVAVASLKVTSCTFGGRDYHELYITTARADEGQHEPHSGGLFKVRLPVSGVK
FT                   SYRFKG"
     gtgcttcagg cggaacttgt attggacatc aaagcaacat tgggggaggg gccttgctgg        60
     gatgaagaca gccagaagct gatctgggtg gatatcgaag gatgcacggt caaccacttt       120
     gatccctcaa cagggatgaa tgcatccacc catgtcggaa agcgtgtcgg agcggcagtc       180
     caaagagatc aaggcggcct tatcctcgca ttggatgacg ggttctatgc atttgatccg       240
     gacagcggcg agctcgttca tctgcatgac ccggagcccg gtgtacagac gaaccggttc       300
     aatgacggaa aatgcgatcc gtccggacgg ttttgggccg ggtccatggt gctgaaagga       360
     agaaaggaac gggcggccct gtaccggatg gatccggacg gctcgcttca catcatggaa       420
     acgggcgtga cgatttccaa tggactggaa ttcgatgagg caaggggcct gatgtactat       480
     atcgattcgg tgacgaaaca gatcgcccgg tatgactatg acggggaatc aggagagatc       540
     cgaaacaaaa ccgcagcgtt ctctgtcgcc gatcagcccg gtgtcccgga tggcatgacc       600
     atcgatgatg aaggcatgct ttgggtggcg ttttttaacg ggggcaaggt agtccggttt       660
     gcccctgatt ccggagcggt gcttgaggaa gtggcagtgg cgtcattgaa agtgacctca       720
     tgtacctttg gaggcagaga ctaccatgag ctgtatatca ccaccgccag ggcggatgaa       780
     ggtcaacatg agcctcattc gggcgggctg tttaaagtcc gtctgccggt ttcgggcgtg       840
     aaatcgtaca ggttcaaagg ataa                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page