(data stored in ACNUC7421 zone)

EMBL: CP001791.PE503

CP001791.PE503       Location/Qualifiers
FT   CDS_pept        complement(549469..550869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0519"
FT                   /product="PAS modulated sigma54 specific transcriptional
FT                   regulator, Fis family"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: sigma-54 factor
FT                   interaction domain-containing protein; helix-turn-helix
FT                   Fis-type; PAS fold-4 domain protein; ATPase associated with
FT                   various cellular activities AAA_5; KEGG: dat:HRM2_07500
FT                   RocR; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98055"
FT                   /db_xref="GOA:D6XXY2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXY2"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADH98055.1"
FT                   /translation="MQPEKLTDTAFIHPVYRKLLDYLDIGIHMINTEGRSVIYNRKMSE
FT                   MEDMNPKEVLNKRIMEIFLFDSEEESRLLQALNNNVVHKDAKQVYFNFKGQEITTVNNT
FT                   FPLTVDGEKIGAVEIARDITKLERLSRETSRGASDARFTFDQIIGNSPAIEDVVENARR
FT                   ATRTTSSVLIYGETGTGKELFAQSIHNGSSRASKPFISQNCAALPDTLIEGILFGSVKG
FT                   AFTGATDHPGLFEQANGGTLMLDEINSLSASLQAKLLRAIQEKTIRRIGDTKSRSVDVR
FT                   IIATMNEDPVDALSKNKLREDLYYRLSVVSIVIPPLRHRKEDLTVLIAHFIRKYNRLFQ
FT                   MNIQEVTDDVFNLFSEYDWPGNVRELEHTIEGAMNLIYDDEPIGFQHLPLHLKHKFTQP
FT                   PATSEGTERLFTQQPEPGLPLETYMDTVEKAYIQKSLTEAGGNISQAARTLGLKRQSLQ
FT                   YRMRKFNL"
     atgcagccgg aaaaactgac tgataccgca ttcattcacc ctgtgtaccg aaagcttctc        60
     gattacctgg atatcggcat tcacatgatc aataccgaag gacggtccgt catctataac       120
     cggaaaatgt ccgaaatgga ggacatgaat ccaaaggaag tattaaacaa acggatcatg       180
     gagattttcc tctttgattc cgaagaggag agccgtcttc tccaggcact gaacaacaac       240
     gttgtccaca aagacgccaa gcaggtctac tttaatttta agggccagga aatcaccacc       300
     gtcaacaata ccttcccgct caccgtggac ggtgagaaga tcggcgcggt ggaaatcgcc       360
     cgggacatca ccaaactcga acgcctttca agggaaacga gccggggagc aagcgacgcc       420
     cggttcacct ttgatcagat catcggaaac agccccgcca ttgaagacgt cgtggaaaat       480
     gcgagacggg ccacaaggac aacgtcttcc gtgctgattt acggggagac aggaaccgga       540
     aaggaactct tcgcccaaag cattcacaac ggaagcagcc gtgcatcgaa accgtttatc       600
     agccaaaact gtgcagccct tcccgatacg ctgattgaag ggattctgtt tggctccgtt       660
     aaaggcgcgt ttaccggcgc aacggatcac cccggcctct ttgaacaggc gaacggcggg       720
     acactgatgc ttgatgagat caactccctc agcgcctctc tccaggcgaa gctcttgcgg       780
     gccattcagg aaaaaacgat ccgcagaatc ggggacacaa aaagccggag cgtagacgtc       840
     aggataatcg ccacgatgaa cgaagatccc gtggacgcac tctccaagaa taagcttcgt       900
     gaagacctgt attaccggct gagtgtcgta tcgattgtca ttccgccgct gagacaccga       960
     aaagaggacc ttactgtttt aattgcccat ttcatacgga aatataacag gctttttcag      1020
     atgaatattc aggaagttac tgatgacgtg ttcaatctgt tcagcgagta tgactggccc      1080
     ggcaacgtca gagagcttga acacacgatc gaaggggcga tgaatctgat ttatgacgac      1140
     gagccgattg gctttcagca ccttcccctt cacctgaaac acaaatttac tcagccgccc      1200
     gccacttccg agggaaccga acgtctcttc acccagcaac ctgaaccggg acttcccctt      1260
     gagacgtata tggatacggt ggaaaaggcc tacattcaaa agtcgctcac agaagccggc      1320
     ggcaacatca gtcaggctgc ccgcacgctc ggcctgaagc ggcagagcct gcagtaccgg      1380
     atgagaaaat tcaacctcta a                                                1401
//

If you have problems or comments...

PBIL Back to PBIL home page