(data stored in ACNUC7421 zone)

EMBL: CP001791.PE504

CP001791.PE504       Location/Qualifiers
FT   CDS_pept        551107..552657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0520"
FT                   /product="delta-1-pyrroline-5-carboxylate dehydrogenase"
FT                   /note="KEGG: geo:Geob_2608 delta-1-pyrroline-5-carboxylate
FT                   dehydrogenase; TIGRFAM: delta-1-pyrroline-5-carboxylate
FT                   dehydrogenase; PFAM: Aldehyde Dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98056"
FT                   /db_xref="GOA:D6XXY3"
FT                   /db_xref="InterPro:IPR005932"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXY3"
FT                   /inference="protein motif:TFAM:TIGR01237"
FT                   /protein_id="ADH98056.1"
FT                   /translation="MVVPYRHEPFTDFTVEENRKDYQEALDYVKSQLGKEYPLIINGEK
FT                   VFTEKKSVSENPANHKEVVGYVSQCSQDLAKQAMEAADEAFTSWKKWDPAARANILFRA
FT                   SAMIRRRKHEFSAWLTYEAGKPWKEADADTAEAIDFLEYYARQILRLKDGIPINSRDGE
FT                   NNTFNYIPLGIGITISPWNFAFAIMAGTTVGPMVAGNTILLKPARTTPVIAYKFMEVLL
FT                   EAGLPKGVVNYVPGSSREIGDYLVDHPRTRFINFTGSKEVGLHIAERAAKVNEGQIWMK
FT                   RMISEMGGKDTIIVDSDADLELAAEAITYSAFGFSGQKCSACSRVIAHKDVYDDVLNRV
FT                   VERTKKLTVGPTFKDNSNFMGPVNDQDAFDKILDYIEVGKKEGRLMVGGTGDNSEGYFI
FT                   HPTVFADVDSKARVMQEEIFGPVVAFDKAEDFDELIEKANNTEYGLTGAVISNNRDHLE
FT                   QARQDFHVGNLYFNRGCTAAIVGYHPFGGFNMSGTDSKAGGPDYLLHFLQPKTVSDMF"
     atggtagtac cttacagaca tgaaccattt acagatttta cggtggagga aaaccgtaaa        60
     gactatcagg aagcgctcga ttatgtaaag agtcagctcg gcaaggaata tccactgatt       120
     attaacggag aaaaagtatt cacagaaaag aaatctgttt cagaaaatcc ggctaaccat       180
     aaagaagttg tcggctacgt atcacagtgc agccaggacc tcgccaaaca ggccatggaa       240
     gctgcggatg aggcgttcac atcgtggaag aaatgggatc cggcggcgcg tgcgaacatt       300
     ctgttccgtg catcagccat gatccgtcgc agaaagcatg aattctcagc ctggctcacg       360
     tatgaagccg ggaagccgtg gaaggaagcg gacgcagata cagcggaagc catcgacttc       420
     cttgaatact atgcccgtca gatccttcgt ctgaaggacg gcattccgat taattcccgt       480
     gacggcgaga acaatacgtt caattatatc ccgctcggta tcgggatcac catttcccct       540
     tggaacttcg cctttgccat catggcagga acgacagtgg ggccgatggt ggcaggaaac       600
     acgatcctcc tgaagccggc aagaacgaca ccggttatcg cctataagtt catggaagtg       660
     ctccttgaag ccggcttgcc aaaaggcgtt gtcaactacg tgccggggtc gagccgtgaa       720
     atcggggatt acctcgtaga tcacccgaga acccgcttta tcaacttcac cggatcgaag       780
     gaagtcggtc tgcatatcgc agagcgcgct gcaaaagtga acgaaggaca gatctggatg       840
     aagcgcatga tctcggagat gggcgggaaa gatacgatca tcgtcgacag cgatgcggat       900
     cttgaactgg ccgcagaagc aatcacgtat tccgcattcg gattctccgg gcagaagtgt       960
     tccgcgtgtt cacgggttat cgcgcataag gatgtgtatg atgatgtcct gaaccgcgtg      1020
     gtggaacgca cgaagaagct gacggtcgga ccgacgttca aggataactc caactttatg      1080
     gggcctgtga atgaccagga tgccttcgat aagattctcg actatattga agtcggcaag      1140
     aaggaaggca ggctgatggt tggcggaaca ggcgataatt cggaagggta cttcattcac      1200
     ccgacggtct ttgccgatgt ggactccaaa gcccgcgtga tgcaagaaga gatctttgga      1260
     ccggtcgttg cctttgataa ggcggaagac ttcgacgagc tcatcgaaaa agccaacaac      1320
     acagagtacg gtctgacggg tgcggtgatt tcgaataacc gtgaccatct tgaacaggcc      1380
     cgtcaggact ttcatgtcgg aaatctgtat ttcaaccgcg gttgtacagc tgcgattgtc      1440
     gggtatcatc cattcggcgg cttcaacatg tccggaacgg actccaaagc cggcggaccg      1500
     gactatctcc tgcacttcct gcagcctaaa accgtatcgg atatgttcta a               1551
//

If you have problems or comments...

PBIL Back to PBIL home page