(data stored in ACNUC7421 zone)

EMBL: CP001791.PE505

CP001791.PE505       Location/Qualifiers
FT   CDS_pept        552739..553932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0521"
FT                   /product="ornithine aminotransferase"
FT                   /note="KEGG: dat:HRM2_23580 RocD1; TIGRFAM: ornithine
FT                   aminotransferase; PFAM: aminotransferase class-III"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98057"
FT                   /db_xref="GOA:D6XXY4"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR010164"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR034757"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXY4"
FT                   /inference="protein motif:TFAM:TIGR01885"
FT                   /protein_id="ADH98057.1"
FT                   /translation="MTKTMDIIEVTEKYGARNYHPLPIVIAKAEGVWVEDPEGNRYIDM
FT                   LSAYSAVNQGHRHPKIIQALKDQADRITLTSRAFHNDQLGAFYEKVSKMTNKDMVLPMN
FT                   TGAEAVETAVKAVRRWAYRVKGVPENQAEIIVCEENFHGRTMTAVSLSSNEAYKKDFGP
FT                   MLPGIKVIPYGDLNALKEAITPNTAAFLFEPIQGEAGINMPPEGFLKEAYELCRENRVL
FT                   YVADEIQCGLARSGKLFACDWEEVEPDMYILGKALGGGVMPISCVAANEEILGVFEPGS
FT                   HGSTFGGNPLSCAVSVAALDVIESEQLAERSLRLGTYFKEQLETLDNPKIREVRGRGLF
FT                   IGVEMTEAARPYCEALKEKGLLCKETHENVIRFAPPLVISEEDLDWAIGQIKDVLKG"
     atgaccaaaa cgatggatat tattgaagtc acggagaaat acggtgcgag gaactaccac        60
     ccgcttccga tcgtgatcgc aaaagccgaa ggtgtctggg tggaggaccc ggaagggaac       120
     cgctatattg acatgctgag tgcctactcc gcggtcaacc aggggcaccg tcatccgaaa       180
     atcattcagg ccctgaagga tcaggcagac cggattaccc tcacttcgag ggcgttccat       240
     aatgatcagc tcggcgcttt ttatgaaaaa gtctccaaga tgacaaataa agacatggtt       300
     ctgccgatga atacgggagc tgaagccgtt gaaactgcgg tcaaagccgt gcggcgctgg       360
     gcgtaccggg tgaaaggcgt gccggaaaac caggcggaaa tcatcgtctg cgaagagaac       420
     tttcacggac ggacgatgac ggctgtttcc ctgtcttcca atgaggcata caaaaaggac       480
     ttcggtccga tgctcccggg aatcaaagtg atcccatacg gcgatttgaa cgcccttaaa       540
     gaagcgatta caccgaatac agcggctttt ctgtttgaac cgattcaggg tgaggcaggc       600
     attaatatgc cgcctgaagg ctttttgaaa gaagcgtatg agctttgccg ggaaaaccgg       660
     gttctttacg tggcggacga aatccagtgc ggtctcgccc gttcaggcaa gctgtttgcc       720
     tgtgactggg aagaggtcga gccggatatg tatattctcg gaaaggccct tgggggcggc       780
     gtcatgccga tctcctgtgt ggcagccaac gaagagattc tcggggtctt tgagccgggc       840
     tctcacggtt ccacgttcgg aggcaacccg ctttcctgcg ccgtttccgt tgcagcgctc       900
     gatgttatag aatccgaaca gctcgcagag cggagtcttc ggctcgggac gtatttcaaa       960
     gaacagctcg agacccttga taacccgaaa atccgggaag tcagaggacg gggactgttt      1020
     atcggggttg aaatgacgga ggcggccaga ccatactgtg aagcattaaa ggaaaagggg      1080
     ctcctttgta aagaaaccca tgagaacgtc atccgatttg caccgccgct cgtgatctct      1140
     gaagaggatc tcgactgggc aatcggacag atcaaagatg tgctgaaagg ctga            1194
//

If you have problems or comments...

PBIL Back to PBIL home page