(data stored in ACNUC7421 zone)

EMBL: CP001791.PE510

CP001791.PE510       Location/Qualifiers
FT   CDS_pept        558630..560324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0526"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mxa:MXAN_0771 iron ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98062"
FT                   /db_xref="GOA:D6XXY9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXY9"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADH98062.1"
FT                   /translation="MTTNHHDKNHDQTNKEMHTEEQKVEGKKPSTILRFMNRRWMDHWS
FT                   GNPPGPILLLIGIVTAILMSVPILYVIWRAVFAGADSWARLLGNRIPGLIWDTLSLVVA
FT                   VTAAAITIGVSVAWLVVRTDLPGRKWLQWMMALPLVIPPYVGAVTYIIVFGPSGWARDL
FT                   WEQSFLDSIIAYPINIYSFWGVFITLTLFTYPYVFLIASASLRKMNKSFEEVARSQGMS
FT                   TAQIFFKVNLPLLRPAIGAGAILISLYVLSDFGAIAMLRYVTFTAAIYYQRAGFDIPAA
FT                   SVLSLVLIVITVLILWLESYTRRKNKYYQTTNSYKEPDILSLGKWKPIATLYIGTVFSL
FT                   AVVLPISVLVYWTVIGAGAGAIDSRFFGFAWNSIKVSGLAAVISMLLATPIIYLKSRHP
FT                   SLTSSTIDKLSYGGYALPGVIVALGLVFIFNNHIPMLYNTFYMIAVAFVVRFLPQAMQA
FT                   GDASLSLVSPRMDEAARSLGYPAWKVMFKVVLPTIMPGVLAGGALVFVSSIKELPATLM
FT                   LRPPGFDTLAVRVYYEASEAIYHQAAPGALLIVLVSIIPLHYLLKKY"
     atgacaacca atcatcacga taagaatcac gatcagacaa ataaagaaat gcatacagaa        60
     gaacagaagg ttgagggcaa aaagccctca accattctgc gtttcatgaa caggcggtgg       120
     atggatcact ggagcgggaa tccgccgggt ccgattctgc tgttaatcgg tatcgtcacg       180
     gcgattctca tgtctgtccc gattctgtat gtgatctggc gcgcggtttt cgcaggtgct       240
     gacagctggg cgcggctgtt ggggaaccgg attcccggcc ttatctggga tacactttcc       300
     cttgttgtcg ccgttaccgc tgcggcgatt acgatcggtg tcagtgtcgc ctggcttgtt       360
     gtcaggacgg atctgccggg gcgcaaatgg cttcagtgga tgatggcact gcctctcgtt       420
     atccctcctt acgtgggggc ggtgacgtac atcattgtgt tcgggccgag cggctgggcg       480
     agggatctgt gggaacaatc gttcctcgac tcgatcatcg cctacccgat aaatatatat       540
     tccttttggg gtgtattcat taccctgacc ctcttcacgt atccgtacgt ctttctgatt       600
     gccagtgcat cactcaggaa gatgaacaaa agctttgaag aggtggcccg ttcacaggga       660
     atgagtacgg cgcagatctt tttcaaggtg aacttgcccc ttttgcggcc ggcgattggt       720
     gccggagcga ttctgatcag tctctatgta ttgtctgatt tcggtgcgat tgcgatgctc       780
     cgctatgtga cgtttactgc agcgatttat taccagcgtg cgggttttga tatcccggct       840
     gcttcggtac tgagtctcgt tctgattgtc attacggtcc tgatcctgtg gctcgaatcg       900
     tatacaagga gaaagaacaa gtactaccag acaacgaact cctacaaaga accggatatt       960
     ctgtccctcg gaaaatggaa gccgattgcg accctttata tcggcacggt tttcagtctt      1020
     gcggtggtcc tgccgatcag tgtccttgtg tactggacgg tcatcggtgc aggtgcaggg      1080
     gccattgaca gccgcttctt cggtttcgcc tggaacagca ttaaagtgtc cggccttgca      1140
     gccgtgattt ccatgctgtt ggcgacaccg atcatttacc tgaaatcccg tcatccgtca      1200
     ctgacgtcta gtacgatcga caagctgagc tatggcggct atgccttgcc gggggtgatt      1260
     gtggcacttg gactggtctt tatctttaac aatcacattc caatgcttta taacacgttt      1320
     tatatgattg ccgttgcgtt tgtcgtgcgc ttcctgccac aggccatgca ggcgggggat      1380
     gcgtctctca gtctcgtgtc accgcggatg gatgaagcgg cgagaagcct cggataccct      1440
     gcctggaagg ttatgttcaa agttgtcctg ccaacgataa tgccgggtgt tctcgcagga      1500
     ggtgccctcg tttttgtcag ttccatcaag gaacttccgg ccacgctcat gcttaggccg      1560
     ccggggtttg ataccctggc ggtgcgggtc tactatgaag cgtcggaagc gatctatcat      1620
     caggcggctc ctggtgccct cctgattgta ttggtctcga tcattccgct gcattatctc      1680
     ctgaagaaat attaa                                                       1695
//

If you have problems or comments...

PBIL Back to PBIL home page