(data stored in ACNUC7421 zone)

EMBL: CP001791.PE517

CP001791.PE517       Location/Qualifiers
FT   CDS_pept        565403..566263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0533"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="PFAM: Rsbr domain protein; Sulfate
FT                   transporter/antisigma-factor antagonist STAS; KEGG:
FT                   bxe:Bxe_B2486 anti-sigma-factor antagonist
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98069"
FT                   /db_xref="GOA:D6XXZ6"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR014792"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXZ6"
FT                   /inference="protein motif:PFAM:PF08678"
FT                   /protein_id="ADH98069.1"
FT                   /translation="MNTFVKESILEQRSAIMNRWIEEIESFRTDDSLQNISNTVYENTN
FT                   REFIDKLFGAIEEGHTKVDRPLDDFAERLIQLGWPLHYLTRGLQEFRKVTIEILSETDS
FT                   DYCQSIEFFQDIESWIDDMVNMLVNQYSGSWENTVFLQKMALKELSAPLIPVFDRISVM
FT                   PLIGTIDTERAKLIMENLLDGVIEHRSQVVLIDITGVPVVDTMVAHHIIQASEAVRLVG
FT                   AKCILVGIRPEIAQTIVNLGIDLGKFPTKSTLKKGIEAALEMTQREIIEFDSVKGGEII
FT                   ADSNT"
     gtgaatacat tcgttaaaga aagcatactt gaacagcgga gcgctatcat gaacaggtgg        60
     attgaagaaa ttgagtcgtt ccgcaccgat gactcactgc agaacatttc aaatacggta       120
     tacgaaaaca cgaacaggga atttattgac aagctttttg gcgccattga agaaggccat       180
     acgaaagtgg accgacctct cgatgatttt gcagaacgcc tgattcagct cggctggccg       240
     cttcattatc tcacacgcgg gcttcaggaa ttccggaaag tgacgatcga aatcctttcg       300
     gaaactgact cggattattg ccagagcatt gagttctttc aggacattga gagttggatc       360
     gacgatatgg tcaatatgct ggtcaaccag tattcaggct catgggaaaa caccgtcttc       420
     cttcagaaga tggcgttaaa agagttatca gcgccactga ttccggtctt tgacagaatc       480
     agtgtaatgc ctctgattgg cacgatcgat acggaacggg cgaagctgat catggagaat       540
     cttctcgacg gggtcattga acaccgttca caggttgtgc tgattgatat caccggcgtg       600
     ccggttgtcg acacgatggt cgcccatcat atcattcagg cttctgaggc tgttcgtctc       660
     gttggagcga agtgcattct tgtcgggatc cgtcctgaga tcgcccagac cattgtcaac       720
     ctggggattg accttggcaa attcccgaca aagagtacgc tcaagaaggg cattgaagcc       780
     gcccttgaga tgacccagcg cgaaatcata gaatttgatt cagtcaaagg aggcgagatc       840
     attgcggatt ccaatactta a                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page