(data stored in ACNUC7421 zone)

EMBL: CP001791.PE521

CP001791.PE521       Location/Qualifiers
FT   CDS_pept        568111..568440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0537"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="KEGG: geo:Geob_3040 anti-sigma-factor antagonist;
FT                   TIGRFAM: anti-anti-sigma factor; PFAM: Sulfate
FT                   transporter/antisigma-factor antagonist STAS"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98073"
FT                   /db_xref="GOA:D6XY00"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY00"
FT                   /inference="protein motif:TFAM:TIGR00377"
FT                   /protein_id="ADH98073.1"
FT                   /translation="MNLSVSVKEGETSNVAYVSGEVDVYTASKLKETLNPLAEQENKDL
FT                   YVDLSNVEYIDSTGLGIFIGTLKLTEKSGSNLKLRGLNDRVLRLFEITGLNEVIEIDAD
FT                   KREEA"
     atgaatttat cagtaagtgt aaaagaagga gaaacgagta atgttgccta tgtatccggt        60
     gaggtggatg tgtatacggc atcaaagctg aaagaaacac tgaatccttt ggcggaacag       120
     gagaacaagg acctgtatgt cgatttgtcc aatgttgagt atattgattc cacagggctc       180
     ggtattttta tcggaactct gaaactcact gaaaagtcag ggagcaactt gaagctccgc       240
     ggtttgaatg accgtgttct cagactgttt gagattacgg gtctgaacga agtcattgag       300
     attgacgccg acaaaaggga ggaagcctga                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page