(data stored in ACNUC7421 zone)

EMBL: CP001791.PE523

CP001791.PE523       Location/Qualifiers
FT   CDS_pept        568900..569706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0539"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="KEGG: mmw:Mmwyl1_3428 RNA polymerase, sigma 28
FT                   subunit, FliA/WhiG; TIGRFAM: RNA polymerase sigma-B factor;
FT                   RNA polymerase sigma-70 factor, sigma-B/F/G subfamily; RNA
FT                   polymerase sigma factor, sigma-70 family; PFAM: sigma-70
FT                   region 4 domain protein; sigma-70 region 3 domain protein;
FT                   sigma-70 region 2 domain protein; Sigma-70 region 4 type 2;
FT                   regulatory protein LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98075"
FT                   /db_xref="GOA:D6XY02"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014288"
FT                   /db_xref="InterPro:IPR014322"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY02"
FT                   /inference="protein motif:TFAM:TIGR02941"
FT                   /protein_id="ADH98075.1"
FT                   /translation="MTREPRKNSRSSKQKEEDKERQLKMIAEFQETGDDEIQTQLVLEY
FT                   ENLVHALARKFSRGQRHDEDLVQVGMIGLLAALRRFDPSFGRSFESFAVPTIVGEIKRF
FT                   IRDKTWSVHVPRRIKELGPKIKSAVENLTTELQRSPQVEEIADYLEVSEEEILETMEMG
FT                   KSYQALSVDRSIEADDEGSAVTLLDLVGSVESGYEQTDQQLLLEKAFQVLTDREKQILQ
FT                   LTYFENMSQKETGEQLGISQMHVSRLQRRALQKLKDSIRIEATEAF"
     gtgacgagag aacctcggaa gaactcccga agcagtaaac agaaggaaga ggacaaagag        60
     cggcaattaa agatgatcgc cgagttccag gaaacgggag acgatgagat ccagacacag       120
     cttgtccttg aatatgagaa tttagtgcat gcgttggcga gaaaattttc gcgtgggcag       180
     cgtcatgatg aggatctggt ccaggttggg atgatcggtc tgctggctgc actgaggcgg       240
     tttgatccct cttttggcag aagttttgaa tccttcgccg ttccgacgat tgtcggagag       300
     atcaaacgct tcatccggga taaaacctgg agcgtccatg tgccaagaag aatcaaagag       360
     ctcggaccaa agatcaagag tgctgttgag aacctgacaa cggagcttca gcgcagtccg       420
     caggttgaag aaattgctga ctaccttgaa gtgagcgaag aagaaattct tgagacgatg       480
     gagatgggca agagctacca ggcgctgtct gttgaccgtt cgattgaagc agatgatgag       540
     ggcagtgccg ttaccctgct cgatcttgtc ggatcggtgg aatcgggtta tgagcaaacg       600
     gatcagcaac tcctccttga gaaggctttt caggtgctga cggatcggga aaaacagatc       660
     ctgcagctga cctatttcga aaacatgagc caaaaagaga caggtgaaca gctgggtata       720
     tcccaaatgc atgtctcacg gctgcagcgg cgtgcgctgc agaaattgaa ggattccatc       780
     aggattgaag cgacggaggc tttctaa                                           807
//

If you have problems or comments...

PBIL Back to PBIL home page