(data stored in ACNUC7421 zone)

EMBL: CP001791.PE527

CP001791.PE527       Location/Qualifiers
FT   CDS_pept        579601..580959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0543"
FT                   /product="cytochrome bd ubiquinol oxidase subunit I"
FT                   /note="PFAM: cytochrome bd ubiquinol oxidase subunit I;
FT                   KEGG: dde:Dde_3204 cytochrome d ubiquinol oxidase, subunit
FT                   I"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98079"
FT                   /db_xref="GOA:D6XY06"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY06"
FT                   /inference="protein motif:PFAM:PF01654"
FT                   /protein_id="ADH98079.1"
FT                   /translation="MLDVLLLSRLQFTFTAVVHYIFIPLTIGLAVFIAYMEFRYWRTKD
FT                   PLYDKMARFWTKLFLINFGVGVATGITMEFQFGTNWAAYSRFVGDVFGAPLAAEGVFAF
FT                   FLESTFIGLLVFGRDKISRGMRFFAALMVAVGTSLSGFWIIAANSWQQTPQGHIINEEL
FT                   NRAEMVSFAEVIFNPSTMVRYLHVMEGAFITAAMFIVAISAYFIIKKKNLPLAKRSMKM
FT                   GIVVGLVFSVLQAFSGHSHAQLVGETQPEKLAAYEAHWETEANAPLLLFAIPDHENERN
FT                   RFEIGIPGMLSFLTYDDVNAEVTGLKEFAAEDRPPVLGNFIAFRVMVTAGIILIGFFMV
FT                   MAWQWRKGNLFEKEKLMKTAFWMLPLPYIANTAGWIVAEWGRQPWAVFGVLRTEDAVSH
FT                   LTAVEVMISLGLFIAIYSFLVWLMVYLMKKEVRKFDMETSMKHLDHPKEGESA"
     atgctggatg tgttattgtt gtcacgcctg cagtttacgt ttacagcggt tgttcactac        60
     atattcatac cgctgacgat cgggctggca gtctttatcg cgtacatgga attccgctat       120
     tggcgaacga aagatccatt gtacgacaaa atggcgagat tctggacaaa gttattcctg       180
     attaacttcg gggtcggggt tgcaacgggg attacgatgg aattccaatt cggaacaaat       240
     tgggcggctt attccaggtt tgtcggggac gtatttggag caccgcttgc agctgagggc       300
     gtatttgcct tcttcctgga gtcaacgttt atcggacttc tcgtttttgg acgcgataaa       360
     atttcgcgtg gaatgcgttt ctttgcagca ctcatggttg cagtgggaac gagcctgtca       420
     ggtttttgga ttatagctgc caactcgtgg caacagacgc cgcagggcca tattatcaat       480
     gaagaactga accgtgccga aatggtaagt tttgcagagg tcatctttaa tccgtccacg       540
     atggtgcgtt atctgcacgt catggaaggg gcctttatta cggcggcgat gtttatcgta       600
     gccatcagtg catactttat cattaagaaa aagaatctgc ctcttgccaa acgctcgatg       660
     aaaatgggga ttgtcgttgg acttgttttc agcgtgcttc aggctttttc aggccactct       720
     catgctcagc ttgttggtga aacgcagcct gaaaagctgg cagcctatga ggcccattgg       780
     gaaacagaag cgaacgcacc gcttttatta tttgcgattc cggatcatga gaatgaacgg       840
     aaccgatttg aaatcggcat tccgggtatg ctcagtttcc tgacctatga tgacgtcaat       900
     gcagaagtga cagggctgaa ggagtttgct gcagaggacc gcccaccggt tctcggcaat       960
     ttcatcgcat tccgtgtcat ggtgacagcg gggataattc tgattggatt ctttatggtc      1020
     atggcctggc agtggcgtaa aggaaatctc tttgaaaaag agaaactgat gaaaactgca      1080
     ttttggatgc ttccactgcc atacatcgcg aacacagcgg ggtggattgt ggctgaatgg      1140
     ggccggcagc cttgggccgt ctttggtgtc ctcagaacag aggatgccgt gtctcacctg      1200
     acggcagtgg aggtaatgat ctcccttggc ctgtttattg ccatatacag tttcctggtc      1260
     tggcttatgg tctatttaat gaaaaaagaa gtacgcaagt ttgatatgga gacatccatg      1320
     aaacaccttg atcatccgaa ggaaggggag tcagcctga                             1359
//

If you have problems or comments...

PBIL Back to PBIL home page