(data stored in ACNUC7421 zone)

EMBL: CP001791.PE53

CP001791.PE53        Location/Qualifiers
FT   CDS_pept        63130..63771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0054"
FT                   /product="ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5"
FT                   /note="KEGG: dat:HRM2_16820 RplY; TIGRFAM: ribosomal 5S
FT                   rRNA E-loop binding protein Ctc/L25/TL5; PFAM: Ribosomal
FT                   protein L25-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97605"
FT                   /db_xref="GOA:D6XV47"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV47"
FT                   /inference="protein motif:TFAM:TIGR00731"
FT                   /protein_id="ADH97605.1"
FT                   /translation="MATILKAAPRNEMKGSTLTTIRSAGWIPAVVYGKEYGNKPVQVEE
FT                   IDFIKTYRAEGKTGVFSLDVEGEKTDVMIYDIQYDMMKNQYVHIDFYAANMKEEMDADV
FT                   PVNVVGEAQGVKDGGVLQQGVFELSVRALPKELPDSIDVNVEELEVNDSIFVKDLKSGA
FT                   DFEFNNDPEEMVVSIVPPTDEPEEETAEEEEGAEPELVAGEEGEEENMEE"
     atggcaacaa tacttaaagc agcaccaaga aacgaaatga aaggttccac attaacaacg        60
     atccgcagcg ccggctggat tcctgccgtc gtatacggta aagaatatgg gaataagcct       120
     gttcaggtgg aggaaattga ttttatcaaa acctaccgcg ctgaagggaa aacaggggta       180
     ttctccctcg acgttgaagg ggaaaaaacg gacgtcatga tttatgacat ccagtatgac       240
     atgatgaaga accagtacgt gcacatcgat ttctatgcag ccaacatgaa agaagagatg       300
     gatgcggatg taccggtgaa cgtggtcggt gaagcgcagg gcgttaaaga cggcggcgtg       360
     cttcagcagg gcgtatttga attgtctgta cgtgcccttc cgaaagaact tcctgacagc       420
     atcgacgtca acgttgaaga gcttgaagtc aacgactcca ttttcgtaaa ggacctgaag       480
     agcggagcgg actttgagtt caataacgat ccggaagaga tggttgtctc catcgtgcct       540
     ccaacagatg agccggaaga agaaacagca gaagaggaag aaggtgcaga gcctgaactc       600
     gttgccggag aagaaggcga agaagagaat atggaagaat aa                          642
//

If you have problems or comments...

PBIL Back to PBIL home page