(data stored in ACNUC7421 zone)

EMBL: CP001791.PE530

CP001791.PE530       Location/Qualifiers
FT   CDS_pept        583700..585412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0546"
FT                   /product="ABC transporter, CydDC cysteine exporter
FT                   (CydDC-E) family, permease/ATP-binding protein CydC"
FT                   /note="TIGRFAM: ABC transporter, CydDC cysteine exporter
FT                   (CydDC-E) family, permease/ATP-binding protein CydC; PFAM:
FT                   ABC transporter related; KEGG: ses:SARI_02008
FT                   cysteine/glutathione ABC transporter membrane/ATP-binding
FT                   component; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98082"
FT                   /db_xref="GOA:D6XY09"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014223"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY09"
FT                   /inference="protein motif:TFAM:TIGR02868"
FT                   /protein_id="ADH98082.1"
FT                   /translation="MRDIKPVLKLMLLEKKEVLLAALLGFLAAGASVGLLASSGFLISS
FT                   AALQPPLYTLTASIVLVRFFGLLRAGSRYGERYFSHKATFTILSHIRTHYFDQVVARIP
FT                   GLFRSKRSGDLLSRITGDVENLQFFFLRVVYPPVVMVLVFLATIFFASLYSFYAAVLLF
FT                   TGFILTGGVIPAWFAWKTRQKAGRVRETRGALSTEVTEFMTGYRELKIHGQTKVKSEDV
FT                   QSLAKAYTSLQQDEQHQLAGSESVNIFAGLMITWLIAFLAALEVQNGSLDGVWLAAMIL
FT                   VSLSVFESANPMASFPKNYESGRQSAERLSLSEGDATDQNGQQGQALSDAIDTIAFKDV
FT                   SFSHEGSERFALSEVSALFKRGQRTAIVGASGSGKTTLMEVLLGIHMADRGDVLVNGQR
FT                   LGDLDLDSCWSQFSFSLQDNHFFYGSIRENLEVPGTGAADQEMTDILERLSLSHLTLDD
FT                   QLEEGAGNLSGGERQRLALARAWLRNGAVWLLDEPLSALDANTYDKVIKEVFDVSAKSM
FT                   MILITHQLRGLEQMDQILVMDQGRIVERGSYHDLMAQKGWFYALHEVDKQMIG"
     atgcgtgata tcaagccggt attgaaactg atgcttcttg agaaaaaaga agtccttctc        60
     gcagcactcc ttggttttct tgcggcagga gcctctgtcg ggcttttggc atcgagcggc       120
     tttcttattt caagcgctgc tcttcagccg ccgctctata cactgacggc gtcgattgtt       180
     ctcgtgcggt ttttcggtct gttgagagca ggaagccgct acggagagcg gtacttctcc       240
     cataaggcaa cgtttacgat cttgagccat atcagaacac attattttga tcaggtcgtc       300
     gcacgtattc cagggctgtt ccgttcaaaa cggagcgggg atctactcag ccggattacg       360
     ggggatgtgg agaatttgca gtttttcttt cttcgtgttg tttacccgcc ggttgtgatg       420
     gtactggtgt ttcttgccac aatttttttt gcatcgctgt attcgtttta tgcagccgtg       480
     cttctcttta ccggtttcat tttgaccgga ggggtaattc ctgcctggtt cgcttggaag       540
     acgaggcaaa aagcaggccg cgtccgggaa acccgtggtg cattatcgac ggaagtgacg       600
     gaattcatga cgggataccg ggaactgaag atacacggac agacaaaggt gaagagtgaa       660
     gacgtgcaga gccttgcgaa ggcgtacacg tccttgcagc aggatgaaca gcatcagctt       720
     gccggaagtg aatccgtcaa tatctttgcc ggccttatga tcacctggct gatcgctttc       780
     ctggccgcgc tggaggtgca aaacggttcg ctcgacggcg tatggcttgc ggcgatgatt       840
     ctcgtatccc tctcggtctt tgaatcggcg aatccgatgg catcatttcc gaagaattat       900
     gagtcgggac gtcagtctgc cgagcggctg tcactgtcag aaggagacgc gacggaccag       960
     aatggccagc agggccaggc actttctgac gcgattgaca ccatagcatt caaagacgtg      1020
     tcgttttctc acgaaggatc agaacggttc gccctgtctg aagtaagtgc attatttaaa      1080
     cggggacagc ggacagccat tgtcggagcg agcggatccg gaaagacaac cctgatggag      1140
     gtacttcttg gcatccacat ggccgatagg ggggacgtgc tcgtcaacgg gcaacgtctc      1200
     ggtgacctcg accttgactc ctgctggtca cagttcagtt tttcattgca ggataatcat      1260
     ttcttttacg gaagtatccg cgagaatctt gaggtgccgg gaacgggtgc agcggatcag      1320
     gagatgacgg atatccttga acgactgtcg ctcagtcacc tcacacttga tgatcagttg      1380
     gaagaagggg cggggaatct ctccgggggt gaacgtcagc gactcgctct cgcccgggca      1440
     tggcttcgaa acggagctgt ctggcttctt gatgaaccgc tgtcggcact tgatgcgaat      1500
     acgtacgata aggtaataaa ggaagttttt gatgtgagtg cgaagagcat gatgattctg      1560
     atcacgcatc agctcagggg gcttgaacag atggatcaga tccttgtgat ggatcagggc      1620
     cggattgtgg aacggggcag ctatcacgat ctcatggcac aaaagggctg gttttatgcc      1680
     ctgcatgagg tggacaaaca aatgatcgga taa                                   1713
//

If you have problems or comments...

PBIL Back to PBIL home page