(data stored in ACNUC7421 zone)

EMBL: CP001791.PE531

CP001791.PE531       Location/Qualifiers
FT   CDS_pept        585684..586817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0547"
FT                   /product="Cystathionine gamma-synthase"
FT                   /EC_number="2.5.1.48"
FT                   /note="KEGG: avn:Avin_43850 cystathionine gamma-synthase;
FT                   PFAM: Cys/Met metabolism pyridoxal-phosphate-dependent
FT                   protein; aromatic amino acid beta-eliminating
FT                   lyase/threonine aldolase; DegT/DnrJ/EryC1/StrS
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98083"
FT                   /db_xref="GOA:D6XY10"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY10"
FT                   /inference="protein motif:PRIAM:2.5.1.48"
FT                   /protein_id="ADH98083.1"
FT                   /translation="MKFRTDNVHLKKAQTSGEYSKTTPIYQTSAFAFKDIDDMEQYFNG
FT                   DKSYLYTRMGNPNTDELGQAVAALEGAEAGVASSSGLSAILAGFLSVAKPGDHVIVAED
FT                   LYGGTFQLINDEIQGLGIRVTFMDMTNVKDVEAAITADTVMIYTESITNPLLRVEDLEG
FT                   ISALAKAHDLKLMVDNTFATPYLIRPLENGADLVVHSATKYIGGHSDVTAGVIVGGEAL
FT                   ISEARKKIVTLGSNLGPFDSWLAVRGLKTLSLRMRAQCENAQKLSDALRQTQGIKKVYY
FT                   PEHASDSGNGAVVTIDLEDGLDVNAFTRALDWVKVVPTLAGVETTVSYPEGTSHRALTP
FT                   EMRTRLGVTPQMIRISVGIEDPDDIVGVFVNAVAAIR"
     gtgaaattca gaacagataa tgtgcatttg aaaaaggcac aaacatcagg agaatacagc        60
     aaaacgaccc cgatctacca gacgtctgcc ttcgcattca aagacattga cgacatggaa       120
     cagtatttta acggtgataa atcgtatctt tacacgcgca tgggcaatcc gaatacggat       180
     gaactcggac aggctgtcgc ggctcttgaa ggggcagagg ccggtgtggc gtcctcttcg       240
     gggttatctg cgattcttgc cggttttttg agtgtggcaa aaccgggtga ccatgtcatt       300
     gtcgcagaag atctgtacgg aggcacgttt cagctgatca acgatgagat tcagggactt       360
     gggatccgtg tcacgtttat ggatatgacg aacgtgaagg acgtcgaggc tgcgattacg       420
     gccgatacgg tcatgattta taccgaatcg attacgaacc cccttcttcg ggtcgaggat       480
     ctcgaaggga tctcggcact cgcgaaggcg catgatctga agctgatggt ggacaatacc       540
     tttgccacgc cttacctgat tcgtccgctt gagaatggcg cggatctcgt cgtgcacagt       600
     gcgaccaaat acatcggcgg gcacagtgat gtgacggccg gtgtcattgt cggcggggaa       660
     gcattgatca gtgaggcaag aaagaagatc gtgacactcg gaagcaatct cgggccattt       720
     gacagctggc ttgcggtgag agggctgaag acgctgagtc tccgtatgcg ggcgcagtgt       780
     gagaatgcgc aaaagctgtc agacgcactg aggcaaacgc aagggataaa gaaggtgtac       840
     tacccggaac atgcgtcaga cagcggaaac ggggccgtcg tcacgatcga tctggaagac       900
     ggacttgacg tgaatgcctt tacgagagca ctggactggg tcaaagtggt gccgacactc       960
     gcaggtgtgg aaacaacggt ctcctatccg gaaggaacct ctcaccgggc cctgacgccg      1020
     gagatgagaa cgagactcgg cgtgacgccg cagatgatcc ggatttccgt cgggattgag      1080
     gatcctgacg atatcgtagg ggttttcgtg aacgcggtgg cggctatcag gtaa            1134
//

If you have problems or comments...

PBIL Back to PBIL home page